Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003680
Gene name
Locationscaffold_01a:959365..961986
Strand-
Gene length (bp)2621
Transcript length (bp)1941
Coding sequence length (bp)1941
Protein length (aa) 647

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08427 ARMH3_C Armadillo-like helical domain-containing protein 3, C-terminal 1.7E-25 422 599

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6PD19|CJ076_MOUSE UPF0668 protein C10orf76 homolog OS=Mus musculus PE=1 SV=2 21 593 1.0E-23
sp|Q5T2E6|CJ076_HUMAN UPF0668 protein C10orf76 OS=Homo sapiens GN=C10orf76 PE=2 SV=1 21 593 2.0E-23
sp|Q6PGW3|CJ076_DANRE UPF0668 protein C10orf76 homolog OS=Danio rerio GN=zgc:63733 PE=2 SV=2 36 564 2.0E-21
sp|Q6DCT2|CJ076_XENLA UPF0668 protein C10orf76 homolog OS=Xenopus laevis PE=2 SV=2 36 593 4.0E-20
sp|O42972|YGZ2_SCHPO UPF0588 membrane protein C20F10.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.02c PE=3 SV=1 124 536 9.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003680
MNIPQRSLQASPKFAKLYSRLFEGIPITEICGPNQTQDHDQFYDELLTLEIDRDFVAGKLANTSRDVLLGASKVF
LNSWFRACIRLTVSTGYDDTKKNNALETLAICVRGVFLKSMSGWEIMEVLAGSVNESDGVLNDFTNMVAAILSDT
QAPTNTRHLALQLALLYMCGAGQSSLGSYFLRRDFFSIIVCFVKSPKTERFSFEATLLLCILANFHRSDAARLNP
YLRKLSTCDDIDFFRKVAWTFNFALNTAVRAYFKLLDDAPQQDLASGIASWISSWRPDKALSPTPIDPPKELFKE
QPIEAAVALLPILEMVIANKIFASILSQEVSSISEKNNASSQQSSPAAFLTVISLSSYILAHASSAASPRALAYA
GLSLKTLLSFLEASELTNGLFNPCQYSIRLCRQRMPMLPFYRGARAPVCAILDCCVLWLRHNLQYKLDVSSYLLS
INIIQRVLWQLRKNNIRLDYDWNDLWSATLGLLNFIATKTQSIVTHTGLESLVDETLALLEYALYQSEKVLSSPG
AIHEFIYQLIRFSDGLRKLKILVFDNKKNLATSLNRTSWISARSTEERLDNILKTVIFYEVKVSSMNAKSAKDAM
RVVAKEVESDGLHGVKPTLDSEPPKRVEEAVSFIRYCYNDILALMP*
Coding >Agabi119p4|003680
ATGAACATTCCTCAAAGGAGTCTCCAGGCCTCTCCGAAATTCGCCAAGTTATACTCTAGACTCTTTGAGGGTATA
CCAATAACAGAAATTTGTGGTCCCAACCAGACACAAGATCATGATCAGTTCTATGACGAGCTCCTGACGTTGGAA
ATAGACCGCGATTTCGTCGCCGGAAAATTAGCAAATACGTCGAGGGACGTTTTATTAGGCGCTTCGAAAGTGTTT
TTAAACTCATGGTTTAGGGCTTGTATACGTTTAACAGTTTCGACTGGATACGACGACACCAAAAAGAACAATGCT
CTGGAAACTCTCGCTATATGCGTGCGAGGCGTATTCTTGAAGTCCATGTCAGGATGGGAGATTATGGAAGTATTA
GCAGGGAGCGTGAATGAGAGTGACGGAGTATTGAACGATTTCACGAACATGGTTGCAGCTATATTATCAGATACT
CAGGCTCCTACTAATACAAGACATCTGGCTCTGCAATTGGCCCTGCTATATATGTGCGGGGCCGGACAGAGTAGT
CTTGGTTCTTACTTTCTTAGGCGGGATTTCTTCTCGATAATCGTTTGTTTCGTCAAAAGTCCCAAGACGGAAAGA
TTCTCATTCGAAGCAACCCTTTTGCTGTGTATTCTCGCTAACTTCCATCGCTCTGACGCCGCTCGTCTCAATCCA
TACCTCAGAAAGTTGTCGACATGCGATGATATAGACTTTTTCAGAAAGGTCGCCTGGACTTTCAACTTTGCTTTG
AATACTGCCGTACGAGCGTATTTCAAGCTTTTGGATGACGCACCTCAGCAAGATCTAGCTTCGGGAATTGCCTCA
TGGATTTCTTCCTGGAGGCCGGACAAGGCACTTTCTCCTACACCTATAGATCCGCCGAAAGAGCTTTTCAAAGAA
CAGCCTATTGAAGCAGCTGTTGCGCTTCTTCCTATCCTAGAGATGGTGATAGCGAACAAAATCTTCGCCTCCATC
TTGTCCCAGGAAGTCTCTTCAATCAGCGAGAAGAACAACGCTTCGAGTCAACAATCCTCACCTGCGGCCTTCCTG
ACAGTGATTTCACTGTCGTCGTACATTCTGGCACATGCCTCCTCTGCCGCATCTCCTAGAGCTCTTGCCTATGCT
GGCCTTTCGTTGAAGACGCTTCTCAGCTTCCTCGAAGCTTCAGAACTCACGAACGGACTCTTCAATCCTTGTCAA
TATTCTATACGGTTGTGTCGACAGAGGATGCCAATGCTTCCGTTTTACAGAGGCGCCAGGGCTCCTGTCTGTGCT
ATATTAGATTGCTGCGTACTTTGGCTCCGGCACAATCTGCAGTATAAGCTGGATGTATCGTCATATCTATTGTCT
ATCAACATCATACAGCGGGTACTGTGGCAATTGCGGAAGAACAATATTCGGCTTGACTATGATTGGAACGATCTA
TGGTCTGCTACCCTGGGCCTTCTCAACTTCATTGCGACCAAAACCCAGAGTATCGTTACTCATACCGGCTTAGAG
TCTCTCGTTGACGAAACTCTTGCTTTATTGGAGTATGCATTGTATCAAAGCGAAAAGGTCCTTTCGTCACCCGGA
GCCATACACGAATTCATTTATCAGCTGATTCGTTTCTCGGATGGTTTACGAAAGCTTAAAATATTAGTTTTTGAC
AATAAGAAGAACCTGGCGACATCATTAAATCGAACGAGCTGGATCAGTGCGCGTAGTACAGAGGAACGACTCGAT
AATATCTTAAAAACTGTGATTTTCTATGAAGTCAAAGTATCAAGTATGAATGCGAAATCAGCAAAAGATGCAATG
AGGGTGGTTGCTAAAGAAGTCGAAAGTGATGGGTTGCATGGAGTTAAGCCGACACTTGACTCGGAACCTCCGAAG
CGCGTCGAGGAAGCAGTGAGCTTTATTCGATACTGCTACAATGATATACTAGCACTTATGCCTTAG
Transcript >Agabi119p4|003680
ATGAACATTCCTCAAAGGAGTCTCCAGGCCTCTCCGAAATTCGCCAAGTTATACTCTAGACTCTTTGAGGGTATA
CCAATAACAGAAATTTGTGGTCCCAACCAGACACAAGATCATGATCAGTTCTATGACGAGCTCCTGACGTTGGAA
ATAGACCGCGATTTCGTCGCCGGAAAATTAGCAAATACGTCGAGGGACGTTTTATTAGGCGCTTCGAAAGTGTTT
TTAAACTCATGGTTTAGGGCTTGTATACGTTTAACAGTTTCGACTGGATACGACGACACCAAAAAGAACAATGCT
CTGGAAACTCTCGCTATATGCGTGCGAGGCGTATTCTTGAAGTCCATGTCAGGATGGGAGATTATGGAAGTATTA
GCAGGGAGCGTGAATGAGAGTGACGGAGTATTGAACGATTTCACGAACATGGTTGCAGCTATATTATCAGATACT
CAGGCTCCTACTAATACAAGACATCTGGCTCTGCAATTGGCCCTGCTATATATGTGCGGGGCCGGACAGAGTAGT
CTTGGTTCTTACTTTCTTAGGCGGGATTTCTTCTCGATAATCGTTTGTTTCGTCAAAAGTCCCAAGACGGAAAGA
TTCTCATTCGAAGCAACCCTTTTGCTGTGTATTCTCGCTAACTTCCATCGCTCTGACGCCGCTCGTCTCAATCCA
TACCTCAGAAAGTTGTCGACATGCGATGATATAGACTTTTTCAGAAAGGTCGCCTGGACTTTCAACTTTGCTTTG
AATACTGCCGTACGAGCGTATTTCAAGCTTTTGGATGACGCACCTCAGCAAGATCTAGCTTCGGGAATTGCCTCA
TGGATTTCTTCCTGGAGGCCGGACAAGGCACTTTCTCCTACACCTATAGATCCGCCGAAAGAGCTTTTCAAAGAA
CAGCCTATTGAAGCAGCTGTTGCGCTTCTTCCTATCCTAGAGATGGTGATAGCGAACAAAATCTTCGCCTCCATC
TTGTCCCAGGAAGTCTCTTCAATCAGCGAGAAGAACAACGCTTCGAGTCAACAATCCTCACCTGCGGCCTTCCTG
ACAGTGATTTCACTGTCGTCGTACATTCTGGCACATGCCTCCTCTGCCGCATCTCCTAGAGCTCTTGCCTATGCT
GGCCTTTCGTTGAAGACGCTTCTCAGCTTCCTCGAAGCTTCAGAACTCACGAACGGACTCTTCAATCCTTGTCAA
TATTCTATACGGTTGTGTCGACAGAGGATGCCAATGCTTCCGTTTTACAGAGGCGCCAGGGCTCCTGTCTGTGCT
ATATTAGATTGCTGCGTACTTTGGCTCCGGCACAATCTGCAGTATAAGCTGGATGTATCGTCATATCTATTGTCT
ATCAACATCATACAGCGGGTACTGTGGCAATTGCGGAAGAACAATATTCGGCTTGACTATGATTGGAACGATCTA
TGGTCTGCTACCCTGGGCCTTCTCAACTTCATTGCGACCAAAACCCAGAGTATCGTTACTCATACCGGCTTAGAG
TCTCTCGTTGACGAAACTCTTGCTTTATTGGAGTATGCATTGTATCAAAGCGAAAAGGTCCTTTCGTCACCCGGA
GCCATACACGAATTCATTTATCAGCTGATTCGTTTCTCGGATGGTTTACGAAAGCTTAAAATATTAGTTTTTGAC
AATAAGAAGAACCTGGCGACATCATTAAATCGAACGAGCTGGATCAGTGCGCGTAGTACAGAGGAACGACTCGAT
AATATCTTAAAAACTGTGATTTTCTATGAAGTCAAAGTATCAAGTATGAATGCGAAATCAGCAAAAGATGCAATG
AGGGTGGTTGCTAAAGAAGTCGAAAGTGATGGGTTGCATGGAGTTAAGCCGACACTTGACTCGGAACCTCCGAAG
CGCGTCGAGGAAGCAGTGAGCTTTATTCGATACTGCTACAATGATATACTAGCACTTATGCCTTAG
Gene >Agabi119p4|003680
ATGAACATTCCTCAAAGGAGTCTCCAGGCCTCTCCGAAATTCGCCAAGTTATACTCTAGACTCTTTGAGGGTATA
CCAATAACAGAAATTTGTGGTCCCAACCAGACACAAGATCATGATCAGTTCTATGACGAGCTCCTGACGTTGGAA
ATAGACCGCGATTTCGTCGCCGGAAAATTAGCAAATACGTCGAGGGACGTTTTATTAGGCGCTTCGAAAGTACGT
TCGGTGAGGATTTAGCGATGAGAAAATCAGTTGCTCATCGAGGTAAGGTGTTTTTAAACTCATGGTTTAGGGCTT
GTATACGTTTAACAGTTTCGACTGGATACGACGACACCAAAAAGAACAATGCTCTGGAAACTCTCGCTATATGCG
TGCGAGGCGTATTCTTGAAGTCCATGTCAGGATGGGAGATTATGGAAGTATTAGCAGGGAGCGTGAATGAGAGTG
ACGGAGTATTGAACGTATGAGAAGTTAATCAATATTCAATACTCAACCTTTACTTATGCATCTGTGCATTAATAT
GTTCGGCAGGATTTCACGAACATGGTTGCAGCTATATTATCAGATACTCAGGCTCCTAGTGAGTTACCTTCCTCT
ACGTGTTACTAGCAGTACTGCTGCTGAAGTTCAATTTCATCTTGTCAGCTAATACAAGACATCTGGCTCTGCAAT
TGGCCCTGCTATATATGTGCGGGGCCGGACAGAGTAGTCTTGGTTCTTACTTTCTTAGGCGGGATTTCTTCTCGA
TAATCGTTTGTGTGAGTGGCTTCCGTAAAAGCTCTACAGATCCCCCCTATTCAAGTTTGTCGCATTTTGGTGAGG
TAGTTCGTCAAAAGTCCCAAGACGGAAAGATTCTCATTCGAAGCAACCCTTTTGCTGTGTATTCTCGCTAACTTC
CATCGCTCTGACGCCGCTCGTCTCAATCCATACCTCAGAAAGTTGTCGACATGCGATGATATAGACTTTTTCAGA
AAGGTCGCCTGGACTTTCAACTTTGCTTTGAATACTGCCGTACGGTTAGTGATACTCACATCTTGGATGTGTTGG
CCAGCATATAGCCACTCATACAACATTCAGAGCGTATTTCAAGCTTTTGGATGACGCACCTCAGCAAGATCTAGC
TTCGGGAATTGCCTCATGGATTTCTTCCTGGAGGCCGGACAAGGCACTTTCTCCTACACCTATAGATCCGCCGAA
AGAGCTTTTCAAAGAACAGTAAAGAATGCCCTTGATTTGTCCTTGGCGCCACCACTTACAACATATGTTCGTGTC
AGGCCTATTGAAGCAGCTGTTGCGCTTCTTCCTATCCTAGAGATGGTGATAGCGAACAAAATCTTCGCCTCCATC
TTGTCCCAGGAAGTCTCTTCAATCAGCGAGAAGAACAACGCTTCGAGTCAACAATCCTCACCTGCGGCCTTCCTG
ACAGTGATTTCACTGTCGTCGTACATTCTGGCACATGCCTCCTCTGCCGCATCTCCTAGAGCTCTTGCCTATGCT
GGCCTTTCGTTGAAGACGCTTCTCAGCTTCCTCGAAGCTTCAGAACTCACGAACGGACTCTTCAATCCTTGTCAA
TATTCTATACGGTTGTGTCGACAGGTGGGCTTAGTTCCGGCTATGTAGCCAGATTTGAAAACCGACCCATCTCCA
GAGGATGCCAATGCTTCCGTTTTACAGAGGCGCCAGGGCTCCTGTCTGTGCTATATTAGATTGCTGCGTACTTTG
GCTCCGGCACAATCTGCAGTATAAGCTGGATGTATCGTCATATCTGTTCGAAGCATCGTCACGAACTTGTGAACC
ACAACTTACCGAGAGTTATCCAGATTGTCTATCAACATCATACAGCGGGTACTGTGGCAATTGCGGAAGAACAAT
ATTCGGCTTGGCGAGTTACTCGTTCACGATAGTGTCATGCTCTATCTCATTTTCGACCAGACTATGATTGGAACG
ATCTATGGTCTGCTACCCTGGGCCTTCTCAACTTCATTGCGACCAAAACCCAGAGTATCGTTACTCATACCGGCT
TAGAGTCTCTCGTTGACGAAGTACATCATTCATTGCGGATGCGATGGGAATCTAACGTCGCTACACTCGCAGACT
CTTGCTTTATTGGAGTATGCATTGTATCAAAGCGAAAAGGTCCTTTCGTCACCCGGAGCCATACACGAATTCATT
GTGAGCCGGTTGCCCTCCGGAAGGTGTGGCTCTAATCTTTATTCTAGTATCAGCTGATTCGTTTCTCGGATGGTT
TACGAAAGCTTAAAATATTAGTTTTTGACAATAAGAAGAACCTGGCGACATCATTAAATCGAACGAGCTGGATCA
GTGCGCGTAGTACAGAGGAACGACTCGATAATATCTTAAAAACTGTGATTTTCTATGAAGTCAAAGTATCAAGTA
TGAATGCGAAATCAGCAAAAGATGCAATGAGGGTGGTTGCTAAAGAAGTCGAAAGTGATGGGTTGCATGGAGTTA
AGCCGACACTTGACTCGGAACCTCCGTAAGTCGGGATCAATTTAACTTGCGATTCCGCTGATCGGCCTAACCACA
GGAAGCGCGTCGAGGAAGCAGTGAGCTTTATTCGATACTGCTACAATGATATACTAGCACTTATGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail