Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003660
Gene name
Locationscaffold_01a:952715..955077
Strand+
Gene length (bp)2362
Transcript length (bp)2253
Coding sequence length (bp)2253
Protein length (aa) 751

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01535 PPR PPR repeat 6.7E-01 346 374
PF01535 PPR PPR repeat 2.4E-01 602 627
PF01535 PPR PPR repeat 5.7E-02 673 693

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 227 708 1.0E-10
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 313 698 2.0E-09
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 366 693 3.0E-08
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 184 637 5.0E-08
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 324 693 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 227 708 1.0E-10
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 313 698 2.0E-09
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 366 693 3.0E-08
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 184 637 5.0E-08
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 324 693 2.0E-07
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 343 707 2.0E-07
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 184 710 2.0E-07
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 335 708 4.0E-07
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 270 685 7.0E-07
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 589 747 8.0E-07
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 343 693 9.0E-07
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 305 692 9.0E-07
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 374 708 1.0E-06
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 302 736 2.0E-06
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 184 687 2.0E-06
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 271 726 2.0E-06
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 252 637 2.0E-06
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 347 662 3.0E-06
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein At1g03560, mitochondrial OS=Arabidopsis thaliana GN=At1g03560 PE=2 SV=1 321 704 5.0E-06
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1 343 689 6.0E-06
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein At1g20300, mitochondrial OS=Arabidopsis thaliana GN=At1g20300 PE=2 SV=1 343 627 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003660
MGFALSFASLVVAHECSYAGHCSRPVAGLSLAAEPSPSPIFAFIRPRLVSTTDIHDICTHYANLVAKLKQAGKLG
SLPTRQILNETQLYRILWLLARSGRPPDVQMLYDILLDMPLVLGLTLTEDTHTAILRGLIYRGEIEVTRRWLERM
PKLPGHITPTLKHYHMFLKALPDMDVCTLRLMRSIVKNMRPVGCKPTYETYEIIWLNRWALYDRGDKVIRPHAAA
VLFDDMERDGLSYNPSFAEVLFQEYNKRGLPLYAEDARNMYEARFLAYDTSASSAYGQMDIKLMRTAQSKGIRSA
ILLFKSWKPHRKPSPEQIRTLLRHSRQLADLRLVEQEFDVKCNVIHWSHLIVNNTRAGQLREALSIYDESKLAGI
IPDTYMTSPLIHALCQSSFAPAQEASVNKALEIYRDLCSAIPSEENDTDHSAGPEQEIYSTLLRGLATVKYPYKY
IDVAKEIMNDMAARGITQDDSNTASSIIALHMRNASNTEEALDVYRRLKSPLDAKGYTVVLNVFCKLRFETTIQI
PSLKGYFEIVKDMRLAGFNTTVEVYTILLHRLSSTATEVQQNDKFPDAPSVIEALTRTLRRVHDLLSLDASLSPD
AVLWNQMISTYQRLGCFADAYRIWEMMYISGQFNDSSVSVILDACAFSGAYSIAKRIIERLMRDNYRFNTHNWST
WLECLCRLGKLDEAIQVLCGEIEGSPQGVTLNAEHVKLVYKFAKSENREGEVLHQIREKSPDLWATLPAHIQGLI
*
Coding >Agabi119p4|003660
ATGGGATTCGCCTTGAGCTTTGCGTCTCTGGTGGTAGCGCATGAATGCTCATATGCAGGACATTGTTCACGGCCG
GTCGCAGGTCTCTCTCTCGCCGCCGAACCATCCCCATCACCCATCTTCGCCTTTATTCGGCCTCGACTCGTATCG
ACCACTGACATCCATGATATTTGTACCCACTACGCTAATCTCGTTGCAAAACTAAAACAAGCCGGAAAATTGGGC
AGCCTCCCAACGCGCCAGATTCTAAATGAGACACAGTTGTACAGAATTTTGTGGCTCCTCGCAAGATCTGGCCGG
CCGCCCGATGTTCAGATGCTCTATGACATTCTCCTGGATATGCCGCTCGTCCTCGGCTTGACGCTGACCGAGGAC
ACACACACTGCTATTCTCCGAGGTCTCATATATCGTGGAGAGATAGAAGTGACGCGCAGATGGCTTGAACGCATG
CCGAAACTTCCTGGTCATATCACTCCGACACTCAAACACTATCATATGTTCCTAAAAGCCCTGCCAGACATGGAT
GTTTGTACACTCAGGCTCATGCGGAGCATAGTTAAAAATATGCGTCCGGTTGGATGCAAGCCAACCTACGAGACC
TACGAAATTATTTGGCTGAATCGATGGGCACTATACGATCGAGGAGATAAAGTCATTCGGCCTCATGCTGCCGCC
GTGCTATTCGACGATATGGAACGCGATGGCTTGTCCTATAATCCGTCTTTTGCAGAGGTCTTGTTCCAGGAATAC
AATAAACGTGGTTTGCCTTTATATGCAGAGGATGCACGGAATATGTATGAGGCCAGGTTTCTCGCCTACGACACG
TCTGCATCTTCGGCATATGGACAGATGGACATAAAGCTTATGCGGACTGCCCAGTCCAAGGGCATCCGATCAGCT
ATTCTTCTTTTCAAGTCCTGGAAACCCCACAGGAAACCATCACCAGAGCAGATACGAACCCTGCTCCGCCACAGT
CGTCAGCTTGCGGACCTTCGCCTTGTTGAGCAAGAGTTTGATGTCAAATGCAATGTCATACACTGGTCCCACCTA
ATAGTGAATAATACCCGTGCTGGCCAACTTCGAGAAGCGCTCTCCATCTATGATGAATCGAAGTTGGCAGGGATC
ATTCCTGATACATACATGACCTCCCCCCTTATTCACGCTCTATGCCAGTCCAGCTTTGCTCCAGCTCAGGAGGCC
AGTGTAAACAAGGCTCTTGAGATATATCGAGACCTTTGCTCAGCAATTCCCTCTGAGGAAAATGATACCGACCAT
TCAGCCGGTCCTGAACAAGAAATCTACTCTACCCTTCTTCGCGGTCTCGCCACTGTCAAATATCCCTACAAATAC
ATAGACGTCGCAAAAGAGATCATGAACGACATGGCTGCTCGAGGGATCACACAAGACGACAGCAACACGGCGAGT
TCCATTATTGCCCTTCACATGCGCAACGCCTCGAACACAGAAGAGGCTCTGGACGTTTACCGACGTCTTAAATCA
CCACTGGATGCAAAGGGCTACACTGTCGTTTTGAACGTCTTCTGCAAATTGCGCTTTGAAACCACCATTCAAATT
CCCTCGCTAAAGGGGTATTTTGAGATTGTCAAGGATATGCGTTTGGCGGGGTTCAACACCACCGTCGAGGTTTAT
ACTATCCTCCTTCATCGACTCAGCTCTACTGCCACCGAAGTTCAACAAAATGATAAATTCCCTGATGCGCCTTCA
GTCATCGAAGCCCTCACTCGCACCCTCCGCCGCGTGCATGATTTACTCAGTCTAGACGCCTCATTATCTCCGGAT
GCAGTGCTTTGGAATCAAATGATAAGCACGTACCAGCGTCTGGGATGTTTTGCCGATGCGTATCGGATTTGGGAG
ATGATGTACATTTCTGGCCAATTTAACGACTCTAGCGTCAGCGTCATCCTTGATGCATGTGCGTTCTCTGGAGCA
TATTCCATTGCGAAACGCATCATAGAGAGGTTAATGAGGGACAATTACCGATTTAACACGCATAACTGGAGTACT
TGGCTGGAGTGTCTATGCAGACTGGGTAAACTCGACGAAGCGATTCAAGTCCTCTGTGGAGAAATTGAAGGTTCG
CCGCAAGGTGTAACACTAAATGCGGAGCATGTGAAGCTTGTATACAAGTTTGCCAAGTCTGAGAACAGGGAGGGA
GAGGTGCTTCATCAGATAAGGGAAAAATCCCCCGATCTTTGGGCCACTTTACCAGCACACATACAAGGACTCATT
TAG
Transcript >Agabi119p4|003660
ATGGGATTCGCCTTGAGCTTTGCGTCTCTGGTGGTAGCGCATGAATGCTCATATGCAGGACATTGTTCACGGCCG
GTCGCAGGTCTCTCTCTCGCCGCCGAACCATCCCCATCACCCATCTTCGCCTTTATTCGGCCTCGACTCGTATCG
ACCACTGACATCCATGATATTTGTACCCACTACGCTAATCTCGTTGCAAAACTAAAACAAGCCGGAAAATTGGGC
AGCCTCCCAACGCGCCAGATTCTAAATGAGACACAGTTGTACAGAATTTTGTGGCTCCTCGCAAGATCTGGCCGG
CCGCCCGATGTTCAGATGCTCTATGACATTCTCCTGGATATGCCGCTCGTCCTCGGCTTGACGCTGACCGAGGAC
ACACACACTGCTATTCTCCGAGGTCTCATATATCGTGGAGAGATAGAAGTGACGCGCAGATGGCTTGAACGCATG
CCGAAACTTCCTGGTCATATCACTCCGACACTCAAACACTATCATATGTTCCTAAAAGCCCTGCCAGACATGGAT
GTTTGTACACTCAGGCTCATGCGGAGCATAGTTAAAAATATGCGTCCGGTTGGATGCAAGCCAACCTACGAGACC
TACGAAATTATTTGGCTGAATCGATGGGCACTATACGATCGAGGAGATAAAGTCATTCGGCCTCATGCTGCCGCC
GTGCTATTCGACGATATGGAACGCGATGGCTTGTCCTATAATCCGTCTTTTGCAGAGGTCTTGTTCCAGGAATAC
AATAAACGTGGTTTGCCTTTATATGCAGAGGATGCACGGAATATGTATGAGGCCAGGTTTCTCGCCTACGACACG
TCTGCATCTTCGGCATATGGACAGATGGACATAAAGCTTATGCGGACTGCCCAGTCCAAGGGCATCCGATCAGCT
ATTCTTCTTTTCAAGTCCTGGAAACCCCACAGGAAACCATCACCAGAGCAGATACGAACCCTGCTCCGCCACAGT
CGTCAGCTTGCGGACCTTCGCCTTGTTGAGCAAGAGTTTGATGTCAAATGCAATGTCATACACTGGTCCCACCTA
ATAGTGAATAATACCCGTGCTGGCCAACTTCGAGAAGCGCTCTCCATCTATGATGAATCGAAGTTGGCAGGGATC
ATTCCTGATACATACATGACCTCCCCCCTTATTCACGCTCTATGCCAGTCCAGCTTTGCTCCAGCTCAGGAGGCC
AGTGTAAACAAGGCTCTTGAGATATATCGAGACCTTTGCTCAGCAATTCCCTCTGAGGAAAATGATACCGACCAT
TCAGCCGGTCCTGAACAAGAAATCTACTCTACCCTTCTTCGCGGTCTCGCCACTGTCAAATATCCCTACAAATAC
ATAGACGTCGCAAAAGAGATCATGAACGACATGGCTGCTCGAGGGATCACACAAGACGACAGCAACACGGCGAGT
TCCATTATTGCCCTTCACATGCGCAACGCCTCGAACACAGAAGAGGCTCTGGACGTTTACCGACGTCTTAAATCA
CCACTGGATGCAAAGGGCTACACTGTCGTTTTGAACGTCTTCTGCAAATTGCGCTTTGAAACCACCATTCAAATT
CCCTCGCTAAAGGGGTATTTTGAGATTGTCAAGGATATGCGTTTGGCGGGGTTCAACACCACCGTCGAGGTTTAT
ACTATCCTCCTTCATCGACTCAGCTCTACTGCCACCGAAGTTCAACAAAATGATAAATTCCCTGATGCGCCTTCA
GTCATCGAAGCCCTCACTCGCACCCTCCGCCGCGTGCATGATTTACTCAGTCTAGACGCCTCATTATCTCCGGAT
GCAGTGCTTTGGAATCAAATGATAAGCACGTACCAGCGTCTGGGATGTTTTGCCGATGCGTATCGGATTTGGGAG
ATGATGTACATTTCTGGCCAATTTAACGACTCTAGCGTCAGCGTCATCCTTGATGCATGTGCGTTCTCTGGAGCA
TATTCCATTGCGAAACGCATCATAGAGAGGTTAATGAGGGACAATTACCGATTTAACACGCATAACTGGAGTACT
TGGCTGGAGTGTCTATGCAGACTGGGTAAACTCGACGAAGCGATTCAAGTCCTCTGTGGAGAAATTGAAGGTTCG
CCGCAAGGTGTAACACTAAATGCGGAGCATGTGAAGCTTGTATACAAGTTTGCCAAGTCTGAGAACAGGGAGGGA
GAGGTGCTTCATCAGATAAGGGAAAAATCCCCCGATCTTTGGGCCACTTTACCAGCACACATACAAGGACTCATT
TAG
Gene >Agabi119p4|003660
ATGGGATTCGCCTTGAGCTTTGCGTCTCTGGTGGTAGGTCGCGTTTTTTCTTTCCACCCGGGCACGCCTCTCACT
TTGAACAGGTAGCGCATGAATGCTCATATGCAGGACATTGTTCACGGCCGGTCGCAGGTCTCTCTCTCGCCGCCG
AACCATCCCCATCACCCATCTTCGCCTTTATTCGGCCTCGGTCAACCCTCCTAATGCCTCTGCATCAACTTCTTC
CTCCATAGACGACGATATCAAAAGACTCGTATCGACCACTGACATCCATGATATTTGTACCCACTACGCTAATCT
CGTTGCAAAACTAAAACAAGCCGGAAAATTGGGCAGCCTCCCAACGCGCCAGATTCTAAATGAGACACAGTTGTA
CAGAATTTTGTGGCTCCTCGCAAGATCTGGCCGGCCGCCCGATGTTCAGATGCTCTATGACATTCTCCTGGATAT
GCCGCTCGTCCTCGGCTTGACGCTGACCGAGGACACACACACTGCTATTCTCCGAGGTCTCATATATCGTGGAGA
GATAGAAGTGACGCGCAGATGGCTTGAACGCATGCCGAAACTTCCTGGTCATATCACTCCGACACTCAAACACTA
TCATATGTTCCTAAAAGCCCTGCCAGACATGGATGTTTGTACACTCAGGCTCATGCGGAGCATAGTTAAAAATAT
GCGTCCGGTTGGATGCAAGCCAACCTACGAGACCTACGAAATTATTTGGCTGAATCGATGGGCACTATACGATCG
AGGAGATAAAGTCATTCGGCCTCATGCTGCCGCCGTGCTATTCGACGATATGGAACGCGATGGCTTGTCCTATAA
TCCGTCTTTTGCAGAGGTCTTGTTCCAGGAATACAATAAACGTGGTTTGCCTTTATATGCAGAGGATGCACGGAA
TATGTATGAGGCCAGGTTTCTCGCCTACGACACGTCTGCATCTTCGGCATATGGACAGATGGACATAAAGCTTAT
GCGGACTGCCCAGTCCAAGGGCATCCGATCAGCTATTCTTCTTTTCAAGTCCTGGAAACCCCACAGGAAACCATC
ACCAGAGCAGATACGAACCCTGCTCCGCCACAGTCGTCAGCTTGCGGACCTTCGCCTTGTTGAGCAAGAGTTTGA
TGTCAAATGCAATGTCATACACTGGTCCCACCTAATAGTGAATAATACCCGTGCTGGCCAACTTCGAGAAGCGCT
CTCCATCTATGATGAATCGAAGTTGGCAGGGATCATTCCTGATACATACATGACCTCCCCCCTTATTCACGCTCT
ATGCCAGTCCAGCTTTGCTCCAGCTCAGGAGGCCAGTGTAAACAAGGCTCTTGAGATATATCGAGACCTTTGCTC
AGCAATTCCCTCTGAGGAAAATGATACCGACCATTCAGCCGGTCCTGAACAAGAAATCTACTCTACCCTTCTTCG
CGGTCTCGCCACTGTCAAATATCCCTACAAATACATAGACGTCGCAAAAGAGATCATGAACGACATGGCTGCTCG
AGGGATCACACAAGACGACAGCAACACGGCGAGTTCCATTATTGCCCTTCACATGCGCAACGCCTCGAACACAGA
AGAGGCTCTGGACGTTTACCGACGTCTTAAATCACCACTGGATGCAAAGGGCTACACTGTCGTTTTGAACGTCTT
CTGCAAATTGCGCTTTGAAACCACCATTCAAATTCCCTCGCTAAAGGGGTATTTTGAGATTGTCAAGGATATGCG
TTTGGCGGGGTTCAACACCACCGTCGAGGTTTATACTATCCTCCTTCATCGACTCAGCTCTACTGCCACCGAAGT
TCAACAAAATGATAAATTCCCTGATGCGCCTTCAGTCATCGAAGCCCTCACTCGCACCCTCCGCCGCGTGCATGA
TTTACTCAGTCTAGACGCCTCATTATCTCCGGATGCAGTGCTTTGGAATCAAATGATAAGCACGTACCAGCGTCT
GGGATGTTTTGCCGATGCGTATCGGATTTGGGAGATGATGTACATTTCTGGCCAATTTAACGACTCTAGCGTCAG
CGTCATCCTTGATGCATGTGCGTTCTCTGGAGCATATTCCATTGCGAAACGCATCATAGAGAGGTTAATGAGGGA
CAATTACCGATTTAACACGCATAACTGGAGTACTTGGCTGGAGTGTCTATGCAGACTGGGTAAACTCGACGAAGC
GATTCAAGTCCTCTGTGGAGAAATTGAAGGTTCGCCGCAAGGTGTAACACTAAATGCGGAGCATGTGAAGCTTGT
ATACAAGTTTGCCAAGTCTGAGAACAGGGAGGGAGAGGTGCTTCATCAGATAAGGGAAAAATCCCCCGATCTTTG
GGCCACTTTACCAGCACACATACAAGGACTCATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail