Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003460
Gene name
Locationscaffold_01a:912908..915248
Strand-
Gene length (bp)2340
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06814 Lung_7-TM_R Lung seven transmembrane receptor 2.5E-64 192 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 190 565 1.0E-55
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 190 565 2.0E-55
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 5 572 2.0E-53
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 190 570 4.0E-46
sp|Q8BKU8|TM87B_MOUSE Transmembrane protein 87B OS=Mus musculus GN=Tmem87b PE=2 SV=1 193 562 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 190 565 1.0E-55
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 190 565 2.0E-55
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 5 572 2.0E-53
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 190 570 4.0E-46
sp|Q8BKU8|TM87B_MOUSE Transmembrane protein 87B OS=Mus musculus GN=Tmem87b PE=2 SV=1 193 562 4.0E-27
sp|Q96K49|TM87B_HUMAN Transmembrane protein 87B OS=Homo sapiens GN=TMEM87B PE=1 SV=1 193 562 1.0E-25
sp|Q28EW0|TM87A_XENTR Transmembrane protein 87A OS=Xenopus tropicalis GN=tmem87a PE=2 SV=1 236 515 3.0E-24
sp|Q8BXN9|TM87A_MOUSE Transmembrane protein 87A OS=Mus musculus GN=Tmem87a PE=1 SV=1 193 562 3.0E-22
sp|Q8NBN3|TM87A_HUMAN Transmembrane protein 87A OS=Homo sapiens GN=TMEM87A PE=1 SV=3 242 502 3.0E-21
sp|Q9Y7Y9|YOD2_SCHPO Uncharacterized membrane protein C18A7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.02c PE=3 SV=1 5 499 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 5 22 17
2 246 265 19
3 280 299 19
4 304 321 17
5 326 343 17
6 356 373 17
7 383 405 22
8 431 453 22
9 468 490 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003460
MFSSLIFLLSFIFYAIAFQVPFTDSDYSRQTCSGMWAGRNTYINVTFGQGSLGQVAMVIYEWADAPFLGKVDAGH
DDDLRVPKTYVCTSDALARGDCTRDQLGRFILDLPQGKPINDTSFWSARVLLSSGAGDPVSTLTTRGINVESLDH
ERRLPISRIEAPWRRDAHVSRENPNPSPGGILSYQAPIHYLVQRTGYYCVAILPVSTSSQNPRADTDVPYHPSYV
GTVLFRNTFDGQLEAIDYPKVNFYFAMSVIYVIFGLAWGWLCWRNSQDLLPLQNYLSGLVGLLVIEMVGNWAYYR
YLNAHGRSTASTIFLIVVSILDAGKASMSFFMLLVVAMGLSVVKESLGRNMFRCQLLACAHFVFGILYSVGIVEL
SLESTSALVLLLFIIPLAFTLSGFLLWIMYSLNTTITYLRERKQRYKLKMFRRLHYILMFVVCTITAFFVVSSFA
FSGRLAEDFEAKQWKIRWWLLDGWLALLYLVSFAAIAFLWRPSANNRRLAMSDEIAQDENDAEDYDLETLHHRQR
LRDDDDDDATLVGTRGGHIPSVVEDHVVFEIGDEDDEDEDAAKKRHPERRSGENLHHSGEREGLMTARND*
Coding >Agabi119p4|003460
ATGTTTTCTTCTTTGATTTTTCTTCTCTCCTTCATCTTCTATGCTATTGCTTTCCAAGTTCCATTCACAGATTCA
GATTATTCCAGACAAACATGCAGTGGCATGTGGGCAGGGCGCAATACATATATCAATGTTACATTTGGTCAAGGC
TCGCTGGGTCAGGTTGCCATGGTCATCTATGAGTGGGCCGACGCACCATTTCTGGGCAAGGTTGACGCAGGTCAT
GATGACGATCTCCGCGTACCTAAAACTTATGTCTGTACCTCTGATGCACTTGCTCGAGGCGACTGCACGCGAGAC
CAGCTTGGACGTTTCATTCTCGACCTCCCTCAAGGCAAACCGATCAATGACACCAGCTTTTGGTCCGCGCGCGTC
CTCTTATCATCGGGCGCTGGGGACCCAGTCTCTACCTTGACTACCAGGGGGATCAACGTGGAGTCTCTTGATCAT
GAGCGACGCTTACCCATATCAAGAATTGAGGCTCCCTGGCGGCGAGATGCGCATGTGAGCAGAGAGAACCCGAAT
CCTAGTCCGGGTGGAATTTTATCGTATCAAGCCCCGATTCATTACCTTGTCCAAAGGACGGGCTATTACTGTGTT
GCCATATTACCTGTCTCAACCAGCTCTCAAAACCCTCGTGCAGATACGGATGTTCCATATCATCCTAGCTATGTT
GGCACCGTATTGTTCAGAAACACATTCGATGGCCAATTGGAGGCCATAGATTATCCCAAAGTTAATTTTTATTTT
GCTATGTCAGTGATATATGTTATTTTCGGTCTTGCCTGGGGTTGGTTGTGCTGGAGGAATTCCCAAGATCTATTA
CCGTTGCAAAATTACCTTTCAGGCCTCGTTGGTCTCCTCGTAATCGAGATGGTAGGAAATTGGGCCTATTACCGC
TACCTTAACGCCCATGGCAGAAGTACGGCCTCAACAATCTTTCTCATCGTCGTATCAATTCTTGATGCCGGAAAA
GCATCCATGTCATTCTTTATGCTACTCGTCGTTGCGATGGGTTTAAGTGTGGTAAAGGAGTCTTTGGGCAGGAAC
ATGTTCAGATGCCAGCTCTTAGCTTGTGCTCATTTCGTTTTTGGCATATTGTATTCTGTCGGCATCGTGGAATTG
TCACTCGAATCGACGTCCGCATTGGTGCTCCTCTTGTTCATCATTCCTTTAGCATTCACTTTAAGCGGATTCCTT
CTTTGGATCATGTATTCCTTGAATACTACCATTACCTATCTCCGTGAACGAAAGCAACGCTATAAACTAAAGATG
TTTAGGCGCCTGCACTATATCCTTATGTTTGTTGTCTGCACTATCACTGCCTTCTTTGTCGTCTCCTCCTTTGCA
TTCTCCGGTCGCTTAGCCGAAGACTTCGAAGCCAAACAATGGAAAATTCGATGGTGGCTCCTTGACGGTTGGCTT
GCCTTGTTATACCTCGTCTCTTTTGCTGCTATCGCGTTTCTGTGGCGCCCGTCTGCAAACAATAGGCGTTTGGCT
ATGTCTGATGAAATCGCTCAAGATGAGAATGATGCCGAAGATTATGATCTCGAGACTCTCCACCATCGCCAACGA
CTGAGGGATGACGATGATGATGATGCTACTCTCGTCGGCACCCGCGGCGGTCATATTCCGTCAGTAGTAGAAGAC
CACGTTGTGTTCGAAATTGGAGACGAAGATGATGAAGACGAAGATGCTGCCAAAAAGCGCCACCCTGAACGTCGT
TCAGGAGAGAATCTGCACCATTCAGGAGAACGGGAAGGTCTTATGACCGCGAGAAACGATTGA
Transcript >Agabi119p4|003460
ATGTTTTCTTCTTTGATTTTTCTTCTCTCCTTCATCTTCTATGCTATTGCTTTCCAAGTTCCATTCACAGATTCA
GATTATTCCAGACAAACATGCAGTGGCATGTGGGCAGGGCGCAATACATATATCAATGTTACATTTGGTCAAGGC
TCGCTGGGTCAGGTTGCCATGGTCATCTATGAGTGGGCCGACGCACCATTTCTGGGCAAGGTTGACGCAGGTCAT
GATGACGATCTCCGCGTACCTAAAACTTATGTCTGTACCTCTGATGCACTTGCTCGAGGCGACTGCACGCGAGAC
CAGCTTGGACGTTTCATTCTCGACCTCCCTCAAGGCAAACCGATCAATGACACCAGCTTTTGGTCCGCGCGCGTC
CTCTTATCATCGGGCGCTGGGGACCCAGTCTCTACCTTGACTACCAGGGGGATCAACGTGGAGTCTCTTGATCAT
GAGCGACGCTTACCCATATCAAGAATTGAGGCTCCCTGGCGGCGAGATGCGCATGTGAGCAGAGAGAACCCGAAT
CCTAGTCCGGGTGGAATTTTATCGTATCAAGCCCCGATTCATTACCTTGTCCAAAGGACGGGCTATTACTGTGTT
GCCATATTACCTGTCTCAACCAGCTCTCAAAACCCTCGTGCAGATACGGATGTTCCATATCATCCTAGCTATGTT
GGCACCGTATTGTTCAGAAACACATTCGATGGCCAATTGGAGGCCATAGATTATCCCAAAGTTAATTTTTATTTT
GCTATGTCAGTGATATATGTTATTTTCGGTCTTGCCTGGGGTTGGTTGTGCTGGAGGAATTCCCAAGATCTATTA
CCGTTGCAAAATTACCTTTCAGGCCTCGTTGGTCTCCTCGTAATCGAGATGGTAGGAAATTGGGCCTATTACCGC
TACCTTAACGCCCATGGCAGAAGTACGGCCTCAACAATCTTTCTCATCGTCGTATCAATTCTTGATGCCGGAAAA
GCATCCATGTCATTCTTTATGCTACTCGTCGTTGCGATGGGTTTAAGTGTGGTAAAGGAGTCTTTGGGCAGGAAC
ATGTTCAGATGCCAGCTCTTAGCTTGTGCTCATTTCGTTTTTGGCATATTGTATTCTGTCGGCATCGTGGAATTG
TCACTCGAATCGACGTCCGCATTGGTGCTCCTCTTGTTCATCATTCCTTTAGCATTCACTTTAAGCGGATTCCTT
CTTTGGATCATGTATTCCTTGAATACTACCATTACCTATCTCCGTGAACGAAAGCAACGCTATAAACTAAAGATG
TTTAGGCGCCTGCACTATATCCTTATGTTTGTTGTCTGCACTATCACTGCCTTCTTTGTCGTCTCCTCCTTTGCA
TTCTCCGGTCGCTTAGCCGAAGACTTCGAAGCCAAACAATGGAAAATTCGATGGTGGCTCCTTGACGGTTGGCTT
GCCTTGTTATACCTCGTCTCTTTTGCTGCTATCGCGTTTCTGTGGCGCCCGTCTGCAAACAATAGGCGTTTGGCT
ATGTCTGATGAAATCGCTCAAGATGAGAATGATGCCGAAGATTATGATCTCGAGACTCTCCACCATCGCCAACGA
CTGAGGGATGACGATGATGATGATGCTACTCTCGTCGGCACCCGCGGCGGTCATATTCCGTCAGTAGTAGAAGAC
CACGTTGTGTTCGAAATTGGAGACGAAGATGATGAAGACGAAGATGCTGCCAAAAAGCGCCACCCTGAACGTCGT
TCAGGAGAGAATCTGCACCATTCAGGAGAACGGGAAGGTCTTATGACCGCGAGAAACGATTGA
Gene >Agabi119p4|003460
ATGTTTTCTTCTTTGATTTTTCTTCTCTCCTTCATCTTCTATGCTATTGCTTTCCAAGTTCCATTCACAGATTCA
GGTATGTTCTCATTTTTGTGGCGTTCTATTATGTCTCATTTCTCTGCCAGATTATTCCAGACAAACATGCAGTGG
CATGTGGGCAGGGCGCAATACATATATCAATGGTGCGCGATATGCTACAACTTTCTCTTCTATCTCTAATATCCA
CTGTCAGTTACATTTGGTCAAGGCTCGCTGGGTCAGGTTGCCATGGTCATCTATGAGTGGGCCGACGCACCATTT
CTGGGCAAGGTTGACGCAGGTCATGATGACGATCTCCGCGTACCTGTAAGAGAAACCGCTTCCTGATTTCATTTT
TAAACTTATCGTCATAGAAAACTTATGTCTGTACCTCTGATGCACTTGCTCGAGGCGACTGCACGCGAGACCAGC
TTGGACGTTTCATTCTCGACCTCCCTCAAGGCAAACCGATCAATGACACCAGCTTTTGGTCCGCGCGCGTCCTCT
TATCATCGGGCGCTGGGGACCCAGTCTCTACCTTGACTACCAGGGGGATCAACGTGGAGTCTCTTGATCATGAGC
GACGCTTACCCATATCAAGAATTGAGGCTCCCTGGCGGCGAGATGCGCATGTGAGCAGAGAGAACCCGAATCCTA
GTCCGGGTGGAATTTTATCGTATCAAGCCCCGATTCATTACCTTGTCCAAAGGACGGGCTATTACTGTGTTGGTG
TGTACATTGGTATCTCTGCCTCTTCTAGCTCAAATCATCTATGCCAGCCATATTACCTGTCTCAACCAGCTCTCA
AAACCCTCGTGCAGATACGGATGTTCCATATCATCCTAGCTATGTTGGCACCGTATTGTTCAGAAACACATTCGA
TGGCCAATTGGAGGCCATAGATTATCCCAAAGTTAATGTATATACTCCTATCATCGCCCTACCCAGGACGCGAGT
CTAACCGTCGTTAAGTTTTATTTTGCTATGTCAGTGATATATGTTATTTTCGGTCTTGCCTGGGGTTGGTTGTGC
TGGAGGAATTCCCAAGATCTATTACCGTTGCAAGTGAGTTCGATTTAGTTCACCGAGATGGGCTAAATTTCATTT
GGCCTAGAATTACCTTTCAGGCCTCGTTGGTCTCCTCGTAATCGAGATGGTAGGAAATTGGGGTATGTGATTGTT
TGCATACATCATTCTGCGGTTAATCATTGTATATCTAGCCTATTACCGCTACCTTAACGCCCATGGCAGAAGTAC
GGCCTCAACAATCTTTCTCATCGTCGGTAAGTGAAACGTCCTATCTTTTCACCCAGAAACTTTTGGCTCATGATC
AACAGTATCAATTCTTGATGCCGGAAAAGCATCCATGTCATTCTTTATGCTACTCGTCGTTGCGATGGGTTTAAG
TGTGGTAAAGGAGTCTTTGGGCAGGAACATGTTCAGATGCCAGCTCTTAGCTTGTGCTCATTTCGTTTTTGGCAG
TAAGTGTCTATTCAAGGACCGTTAACTGCGTTTTTACATTTTCACAGTATTGTATTCTGTCGGCATCGTGGAATT
GTCACTCGAATCGACGTCCGCATTGGTGCTCCTCTTGTTCATCATTCCTTTAGCATTCACTTTAAGCGGATTCCT
TCTTTGGATCATGTATTCCTTGAATAGTACGTTTAAATTTCCACATACTGTATCTGGACGTTGACTGACCTGGTA
TAGCTACCATTACCTATCTCCGTGAACGAAAGCAACGCTATAAACTAAAGATGTTTAGGCGCCTGCACTATATCC
TTATGTTTGTTGTCTGCACTATCACTGCCTTCTTTGTCGTCTCCTCCTTTGCATTCTCCGGTCGCTTAGCCGAAG
GTAGGAAATTATTGTTTTATTTAGATTTGAAGTTGATATCCCCGTTTAGACTTCGAAGCCAAACAATGGAAAATT
CGATGGTGGCTCCTTGACGGTTGGCTTGCCTTGTTATACCTCGTCTCTTTTGCTGCTATCGCGTTTCTGTGGCGC
CCGTCTGCAAACAATAGGCGTTTGGCTATGTCTGATGAAATCGCTCAAGATGAGAATGATGCCGAAGATTATGAT
CTCGAGACTCTCCACCATCGCCAACGACTGAGGGATGACGATGATGATGATGCTACTCTCGTCGGCACCCGCGGC
GGTCATATTCCGTCAGTAGTAGAAGACCACGTTGTGTTCGAAATTGGAGACGAAGATGATGAAGACGAAGATGCT
GCCAAAAAGCGCCACCCTGAACGTCGTTCAGGAGAGAATCTGCACCATTCAGGAGAACGGGAAGGTCTTATGACC
GCGAGAAACGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail