Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003420
Gene name
Locationscaffold_01a:905483..907090
Strand-
Gene length (bp)1607
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family 2.0E-62 37 392

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94467|OYEC_SCHPO Putative NADPH dehydrogenase C23G7.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23G7.10c PE=3 SV=1 37 406 1.0E-116
sp|C5D427|NAMA_GEOSW NADPH dehydrogenase OS=Geobacillus sp. (strain WCH70) GN=namA PE=3 SV=1 38 407 3.0E-103
sp|Q5KXG9|NAMA_GEOKA NADPH dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=namA PE=1 SV=1 38 407 2.0E-101
sp|Q9KCT8|NAMA_BACHD NADPH dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=namA PE=3 SV=1 37 407 6.0E-98
sp|A4IQK7|NAMA_GEOTN NADPH dehydrogenase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=namA PE=3 SV=1 38 407 6.0E-97
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94467|OYEC_SCHPO Putative NADPH dehydrogenase C23G7.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23G7.10c PE=3 SV=1 37 406 1.0E-116
sp|C5D427|NAMA_GEOSW NADPH dehydrogenase OS=Geobacillus sp. (strain WCH70) GN=namA PE=3 SV=1 38 407 3.0E-103
sp|Q5KXG9|NAMA_GEOKA NADPH dehydrogenase OS=Geobacillus kaustophilus (strain HTA426) GN=namA PE=1 SV=1 38 407 2.0E-101
sp|Q9KCT8|NAMA_BACHD NADPH dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=namA PE=3 SV=1 37 407 6.0E-98
sp|A4IQK7|NAMA_GEOTN NADPH dehydrogenase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=namA PE=3 SV=1 38 407 6.0E-97
sp|Q63CC9|NAMA_BACCZ NADPH dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=namA PE=3 SV=1 37 406 3.0E-93
sp|B9IY25|NAMA_BACCQ NADPH dehydrogenase OS=Bacillus cereus (strain Q1) GN=namA PE=3 SV=1 37 406 7.0E-93
sp|Q739N4|NAMA_BACC1 NADPH dehydrogenase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=namA PE=3 SV=1 37 406 9.0E-93
sp|A7GNY4|NAMA_BACCN NADPH dehydrogenase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=namA PE=3 SV=1 37 406 1.0E-92
sp|Q65HN9|NAMA_BACLD NADPH dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=namA PE=3 SV=1 37 407 2.0E-92
sp|B7JKM7|NAMA_BACC0 NADPH dehydrogenase OS=Bacillus cereus (strain AH820) GN=namA PE=3 SV=1 37 406 2.0E-92
sp|Q81RK6|NAMA_BACAN NADPH dehydrogenase OS=Bacillus anthracis GN=namA PE=3 SV=1 37 406 5.0E-92
sp|C3L5F3|NAMA_BACAC NADPH dehydrogenase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=namA PE=3 SV=1 37 406 5.0E-92
sp|C3P7Z9|NAMA_BACAA NADPH dehydrogenase OS=Bacillus anthracis (strain A0248) GN=namA PE=3 SV=1 37 406 5.0E-92
sp|B7HNI1|NAMA_BACC7 NADPH dehydrogenase OS=Bacillus cereus (strain AH187) GN=namA PE=3 SV=1 37 406 7.0E-92
sp|A7Z6E7|NAMA_BACMF NADPH dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=namA PE=3 SV=1 37 407 8.0E-92
sp|A9VRT5|NAMA_BACWK NADPH dehydrogenase OS=Bacillus weihenstephanensis (strain KBAB4) GN=namA PE=3 SV=1 37 406 1.0E-91
sp|P54550|NAMA_BACSU NADPH dehydrogenase OS=Bacillus subtilis (strain 168) GN=namA PE=1 SV=3 37 407 2.0E-91
sp|Q6HJU1|NAMA_BACHK NADPH dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=namA PE=3 SV=1 37 406 6.0E-91
sp|C1ERH2|NAMA_BACC3 NADPH dehydrogenase OS=Bacillus cereus (strain 03BB102) GN=namA PE=3 SV=1 37 406 7.0E-91
sp|A0RD27|NAMA_BACAH NADPH dehydrogenase OS=Bacillus thuringiensis (strain Al Hakam) GN=namA PE=3 SV=1 37 406 7.0E-91
sp|Q81EF6|NAMA_BACCR NADPH dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=namA PE=3 SV=2 37 406 2.0E-90
sp|B7HJE9|NAMA_BACC4 NADPH dehydrogenase OS=Bacillus cereus (strain B4264) GN=namA PE=3 SV=1 37 406 8.0E-90
sp|B7ITF9|NAMA_BACC2 NADPH dehydrogenase OS=Bacillus cereus (strain G9842) GN=namA PE=3 SV=1 37 406 7.0E-89
sp|Q928C2|NAMA_LISIN NADPH dehydrogenase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=namA PE=3 SV=1 35 407 5.0E-87
sp|Q8Y4H1|NAMA_LISMO NADPH dehydrogenase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=namA PE=3 SV=1 35 407 1.0E-86
sp|Q71WV6|NAMA_LISMF NADPH dehydrogenase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=namA PE=3 SV=1 35 407 2.0E-86
sp|C1KYN8|NAMA_LISMC NADPH dehydrogenase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=namA PE=3 SV=1 35 407 2.0E-86
sp|A0ALF5|NAMA_LISW6 NADPH dehydrogenase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=namA PE=3 SV=1 35 407 3.0E-86
sp|B8DBP0|NAMA_LISMH NADPH dehydrogenase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=namA PE=3 SV=1 35 407 4.0E-86
sp|A8FEW4|NAMA_BACP2 NADPH dehydrogenase OS=Bacillus pumilus (strain SAFR-032) GN=namA PE=3 SV=1 37 407 9.0E-84
sp|Q97E86|NAMA_CLOAB NADPH dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=namA PE=3 SV=1 37 407 1.0E-69
sp|P32382|NADO_THEBR NADH oxidase OS=Thermoanaerobacter brockii PE=1 SV=1 36 389 5.0E-38
sp|P19410|BAICD_CLOSV Bile acid-inducible operon protein CD OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiCD PE=3 SV=2 38 385 1.0E-33
sp|P54524|YQIG_BACSU Probable NADH-dependent flavin oxidoreductase YqiG OS=Bacillus subtilis (strain 168) GN=yqiG PE=3 SV=1 38 267 4.0E-27
sp|C5H429|DBR2_ARTAN Artemisinic aldehyde Delta(11(13)) reductase OS=Artemisia annua GN=DBR2 PE=1 SV=1 34 406 2.0E-26
sp|P77258|NEMA_ECOLI N-ethylmaleimide reductase OS=Escherichia coli (strain K12) GN=nemA PE=2 SV=1 37 392 7.0E-26
sp|P16099|DHTM_METME Trimethylamine dehydrogenase OS=Methylophilus methylotrophus GN=tmd PE=1 SV=3 38 386 5.0E-25
sp|Q69TH6|OPR3_ORYSJ Putative 12-oxophytodienoate reductase 3 OS=Oryza sativa subsp. japonica GN=OPR3 PE=3 SV=1 38 386 2.0E-24
sp|Q9FUP0|OPR3_ARATH 12-oxophytodienoate reductase 3 OS=Arabidopsis thaliana GN=OPR3 PE=1 SV=2 38 285 3.0E-24
sp|Q84QK0|OPR1_ORYSJ 12-oxophytodienoate reductase 1 OS=Oryza sativa subsp. japonica GN=OPR1 PE=2 SV=1 38 406 3.0E-24
sp|Q69TH4|OPR2_ORYSJ Putative 12-oxophytodienoate reductase 2 OS=Oryza sativa subsp. japonica GN=OPR2 PE=3 SV=1 33 277 4.0E-24
sp|Q9FEW9|OPR3_SOLLC 12-oxophytodienoate reductase 3 OS=Solanum lycopersicum GN=OPR3 PE=1 SV=1 38 274 8.0E-24
sp|Q6Z965|OPR7_ORYSJ 12-oxophytodienoate reductase 7 OS=Oryza sativa subsp. japonica GN=OPR7 PE=2 SV=1 30 285 3.0E-23
sp|G9F1Y9|FLDZ_CLOS3 2-enoate reductase FldZ OS=Clostridium sporogenes (strain ATCC 7955 / DSM 767 / NBRC 16411 / NCIMB 8053 / NCTC 8594 / PA 3679) GN=fldZ PE=1 SV=1 38 400 1.0E-22
sp|Q69TH8|OPR4_ORYSJ Putative 12-oxophytodienoate reductase 4 OS=Oryza sativa subsp. japonica GN=OPR4 PE=2 SV=1 38 406 1.0E-22
sp|P32370|BAIH_CLOSV NADH-dependent flavin oxidoreductase OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiH PE=3 SV=1 32 383 2.0E-22
sp|B9FFD3|OPR13_ORYSJ Putative 12-oxophytodienoate reductase 13 OS=Oryza sativa subsp. japonica GN=OPR13 PE=2 SV=1 38 406 7.0E-22
sp|P42593|FADH_ECOLI 2,4-dienoyl-CoA reductase [NADPH] OS=Escherichia coli (strain K12) GN=fadH PE=1 SV=3 36 382 1.0E-21
sp|Q9XG54|OPR1_SOLLC 12-oxophytodienoate reductase 1 OS=Solanum lycopersicum GN=OPR1 PE=1 SV=1 31 274 3.0E-21
sp|P0DI09|ORL2B_ARATH Putative 12-oxophytodienoate reductase-like protein 2B OS=Arabidopsis thaliana GN=At1g18020 PE=3 SV=1 85 300 3.0E-21
sp|P0DI08|ORL2A_ARATH Putative 12-oxophytodienoate reductase-like protein 2A OS=Arabidopsis thaliana GN=At1g17990 PE=2 SV=1 85 300 3.0E-21
sp|Q8GYA3|OPRL1_ARATH Putative 12-oxophytodienoate reductase-like protein 1 OS=Arabidopsis thaliana GN=At1g09400 PE=2 SV=2 44 386 4.0E-21
sp|Q8GYB8|OPR2_ARATH 12-oxophytodienoate reductase 2 OS=Arabidopsis thaliana GN=OPR2 PE=1 SV=2 38 386 4.0E-21
sp|P0DN73|OYE_STRPG Uncharacterized oxidoreductase SpyM50865 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=SpyM50865 PE=1 SV=1 38 267 5.0E-21
sp|Q48303|DHDM_HYPSX Dimethylamine dehydrogenase OS=Hyphomicrobium sp. (strain x) GN=dmd PE=3 SV=3 38 386 5.0E-21
sp|P43084|EBP1_CANAX Probable NADPH dehydrogenase OS=Candida albicans GN=EBP1 PE=1 SV=2 37 264 6.0E-21
sp|Q0E0C6|OPR8_ORYSJ Putative 12-oxophytodienoate reductase 8 OS=Oryza sativa subsp. japonica GN=OPR8 PE=2 SV=1 30 406 6.0E-21
sp|Q8LAH7|OPR1_ARATH 12-oxophytodienoate reductase 1 OS=Arabidopsis thaliana GN=OPR1 PE=1 SV=2 38 386 1.0E-20
sp|Q69TI0|OPR5_ORYSJ Putative 12-oxophytodienoate reductase 5 OS=Oryza sativa subsp. japonica GN=OPR5 PE=2 SV=1 47 386 2.0E-20
sp|Q69TI2|OPR6_ORYSJ Putative 12-oxophytodienoate reductase 6 OS=Oryza sativa subsp. japonica GN=OPR6 PE=2 SV=1 31 386 1.0E-19
sp|B9FSC8|OPR11_ORYSJ Putative 12-oxophytodienoate reductase 11 OS=Oryza sativa subsp. japonica GN=OPR11 PE=2 SV=1 38 386 1.0E-19
sp|Q4WZ70|OYE3_ASPFU Chanoclavine-I aldehyde reductase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaOx3 PE=1 SV=1 33 263 1.0E-18
sp|P41816|OYE3_YEAST NADPH dehydrogenase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OYE3 PE=1 SV=2 37 263 6.0E-18
sp|Q0JMR0|OPR10_ORYSJ Putative 12-oxophytodienoate reductase 10 OS=Oryza sativa subsp. japonica GN=OPR10 PE=2 SV=1 187 406 3.0E-17
sp|Q6ZXC1|EASA_CLAPU Probable inactive dehydrogenase EasA OS=Claviceps purpurea GN=easA PE=3 SV=2 37 253 6.0E-17
sp|Q03558|OYE2_YEAST NADPH dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OYE2 PE=1 SV=3 37 258 3.0E-16
sp|Q02899|OYE1_SACPS NADPH dehydrogenase 1 OS=Saccharomyces pastorianus GN=OYE1 PE=1 SV=3 37 263 4.0E-16
sp|O87278|STCD_RHIME Probable N-methylproline demethylase OS=Rhizobium meliloti (strain 1021) GN=stcD PE=2 SV=2 38 400 5.0E-16
sp|P40952|KYE1_KLULA Enoate reductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KYE1 PE=1 SV=2 38 255 2.0E-14
sp|B9FFD2|OPR12_ORYSJ Putative 12-oxophytodienoate reductase 12 OS=Oryza sativa subsp. japonica GN=OPR12 PE=2 SV=2 38 406 4.0E-14
sp|Q5ZC83|OPR9_ORYSJ Putative 12-oxophytodienoate reductase 9 OS=Oryza sativa subsp. japonica GN=OPR9 PE=2 SV=1 106 274 1.0E-13
sp|Q9FEX0|OPRL_SOLLC 12-oxophytodienoate reductase-like protein OS=Solanum lycopersicum GN=OPR2 PE=2 SV=1 60 406 9.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0010181 FMN binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003420
MSPLIINKAVPGAREFYPLNEPEIGTLWRPDDREVPKLFQPLTIRGITFKNRIWVSPMCQYSADNGHLTEWHLVH
LGGFATRGVGAVTVEATAVVPEGRISPEDSGLWTDTQIDPLRRIVSFVHAQATKIGIQLAHAGRKASTHAPWIEE
AAGRGTLSIATKEENGWPDEVYGPSTLSYKDGKYPNPKEMTESDINKVVDAFIASTKRAEQAGFDFIEVHGAHGY
LIHSFLSPLSNTRNDAYGGQSLENRLRFICTLVQRLREIWSKPLFVRISATDWAEGPEKDSDGKWLQWGIEQSTI
LATRLQTLGVDLIDCSTGGNWASQKIPVAPGYQVPFAAQLKKALPDLLVGTVGLITEAEQAESFLKEGKADVILL
ARALLRDPHWPLHAARKLGVKIKPAGQYERAWAAL*
Coding >Agabi119p4|003420
ATGTCACCTCTTATCATCAACAAGGCCGTACCAGGCGCAAGGGAATTCTATCCACTAAATGAACCGGAGATCGGC
ACCTTATGGCGGCCCGATGATAGAGAAGTACCGAAACTTTTCCAGCCTCTGACAATCAGGGGAATCACCTTCAAG
AATAGAATTTGGGTGTCTCCCATGTGCCAATATAGTGCTGATAACGGTCATCTGACCGAATGGCATCTTGTACAC
CTTGGAGGGTTTGCGACCAGAGGCGTGGGTGCAGTTACTGTAGAGGCAACTGCTGTTGTTCCAGAAGGAAGAATT
TCACCCGAAGACTCTGGACTATGGACGGATACGCAAATTGACCCTCTCAGACGAATTGTTTCCTTTGTCCACGCA
CAGGCTACGAAAATTGGAATACAACTGGCTCATGCGGGTCGGAAGGCATCTACTCATGCTCCCTGGATCGAAGAA
GCTGCAGGCAGGGGTACTCTGTCCATCGCTACAAAAGAGGAAAACGGCTGGCCCGACGAAGTTTACGGCCCAAGT
ACTTTGTCATACAAGGATGGAAAGTATCCAAACCCGAAAGAGATGACCGAGAGTGACATCAACAAAGTCGTTGAT
GCTTTCATTGCATCTACGAAACGTGCGGAGCAGGCAGGTTTTGACTTCATCGAAGTTCATGGTGCGCATGGTTAT
TTAATCCACTCATTCCTTTCGCCTCTCTCCAACACTCGCAACGATGCATACGGGGGTCAATCTTTGGAAAATCGC
CTTCGCTTTATCTGCACTCTGGTCCAAAGGCTGCGAGAGATCTGGTCCAAGCCACTGTTTGTTCGTATCAGCGCC
ACAGATTGGGCCGAGGGACCAGAGAAGGATTCTGATGGGAAATGGCTTCAATGGGGAATTGAACAAAGCACCATC
CTAGCAACTCGGTTGCAAACCTTAGGCGTCGACTTAATTGACTGCAGTACGGGTGGCAATTGGGCATCTCAAAAA
ATTCCAGTTGCCCCTGGATATCAGGTTCCTTTCGCTGCCCAGTTGAAGAAAGCACTACCAGATCTTCTTGTTGGC
ACCGTGGGGCTCATAACTGAGGCTGAACAAGCTGAATCGTTCTTGAAAGAAGGAAAAGCTGATGTCATACTACTG
GCCAGGGCCCTCCTACGTGACCCTCACTGGCCCCTACACGCTGCTCGGAAGCTTGGAGTCAAGATCAAACCTGCA
GGACAGTATGAGCGCGCCTGGGCAGCGCTTTAG
Transcript >Agabi119p4|003420
ATGTCACCTCTTATCATCAACAAGGCCGTACCAGGCGCAAGGGAATTCTATCCACTAAATGAACCGGAGATCGGC
ACCTTATGGCGGCCCGATGATAGAGAAGTACCGAAACTTTTCCAGCCTCTGACAATCAGGGGAATCACCTTCAAG
AATAGAATTTGGGTGTCTCCCATGTGCCAATATAGTGCTGATAACGGTCATCTGACCGAATGGCATCTTGTACAC
CTTGGAGGGTTTGCGACCAGAGGCGTGGGTGCAGTTACTGTAGAGGCAACTGCTGTTGTTCCAGAAGGAAGAATT
TCACCCGAAGACTCTGGACTATGGACGGATACGCAAATTGACCCTCTCAGACGAATTGTTTCCTTTGTCCACGCA
CAGGCTACGAAAATTGGAATACAACTGGCTCATGCGGGTCGGAAGGCATCTACTCATGCTCCCTGGATCGAAGAA
GCTGCAGGCAGGGGTACTCTGTCCATCGCTACAAAAGAGGAAAACGGCTGGCCCGACGAAGTTTACGGCCCAAGT
ACTTTGTCATACAAGGATGGAAAGTATCCAAACCCGAAAGAGATGACCGAGAGTGACATCAACAAAGTCGTTGAT
GCTTTCATTGCATCTACGAAACGTGCGGAGCAGGCAGGTTTTGACTTCATCGAAGTTCATGGTGCGCATGGTTAT
TTAATCCACTCATTCCTTTCGCCTCTCTCCAACACTCGCAACGATGCATACGGGGGTCAATCTTTGGAAAATCGC
CTTCGCTTTATCTGCACTCTGGTCCAAAGGCTGCGAGAGATCTGGTCCAAGCCACTGTTTGTTCGTATCAGCGCC
ACAGATTGGGCCGAGGGACCAGAGAAGGATTCTGATGGGAAATGGCTTCAATGGGGAATTGAACAAAGCACCATC
CTAGCAACTCGGTTGCAAACCTTAGGCGTCGACTTAATTGACTGCAGTACGGGTGGCAATTGGGCATCTCAAAAA
ATTCCAGTTGCCCCTGGATATCAGGTTCCTTTCGCTGCCCAGTTGAAGAAAGCACTACCAGATCTTCTTGTTGGC
ACCGTGGGGCTCATAACTGAGGCTGAACAAGCTGAATCGTTCTTGAAAGAAGGAAAAGCTGATGTCATACTACTG
GCCAGGGCCCTCCTACGTGACCCTCACTGGCCCCTACACGCTGCTCGGAAGCTTGGAGTCAAGATCAAACCTGCA
GGACAGTATGAGCGCGCCTGGGCAGCGCTTTAG
Gene >Agabi119p4|003420
ATGTCACCTCTTATCATCAACAAGGCCGTACCAGGCGCAAGGGAATTCTATCCACTAAATGAACCGGAGATCGGC
ACCTTATGGCGGCCCGATGTATGCTTTCTTTCTGTCAGTGTCCATAATTCCGCTGACGTCGAGTGTCAGGATAGA
GAAGTACCGAAACTTTTCCAGCCTCTGACAATCAGGGGAATCACCTTCAAGAATAGAATTTGGGTGGTAAGTAGA
CGCTTGCTCTTCTAGCAAATTGATTGCCAAAAACATTTTCAGTCTCCCATGTGCCAATATAGTGCTGATAACGGT
CATCTGACCGAATGGCATCTTGTACACCTTGGAGTAAGACAGGCCGCATTGCTTTGCAGGTCGACCTCCTCTTAT
CAATAGCTTTCCTTAGGGGTTTGCGACCAGAGGCGTGGGTGCAGTTACTGTAGAGGCAACTGCTGTTGTTCCAGA
AGGAAGAATTTCACCCGAAGACTCTGTTAGTGTCGTCTATCTTCCCAGGACCTACGTATTTGATTCACCGAATGA
TAGGGACTATGGACGGATACGCAAATTGACCCTCTCAGACGAATTGTTTCCTTTGTCCACGCACAGGCTACGAAA
ATTGGAATACAACTGGCTCATGCGGGTCGGAAGGCATCTACTCATGCTCCCTGGATCGAAGAAGCTGCAGGCAGG
GGTACTCTGTCCATCGCTACAAAAGAGGAAAACGGCTGGCCCGACGAAGGTATTATTAGCCTTATCACTAAGTCA
AGAATTATCTTATCATATCTCCTGATAGTTTACGGCCCAAGTACTTTGTCATACAAGGATGGAAAGTATCCAAAC
CCGAAAGAGATGACCGAGAGTGACATCAACAAAGTCGTTGATGCTTTCATTGCATCTACGAAACGTGCGGAGCAG
GCAGGTTGTGAGTAATTGCTTATTTTGTGCGTTTGAAATGGTATCGAGTCAGTGTTCTAGTTGACTTCATCGAAG
TTCATGGTGCGCATGGTTATTTAATCCACTCATTCCTTTCGCCTCTCTCCAACACTCGCAACGATGCATACGGGG
GTCAATCTTTGGAAAATCGCCTTCGCTTTATCTGCACTCTGGTCCAAAGGCTGCGAGAGATCTGGTCCAAGCCAC
TGTTTGTTCGTATCAGCGCCACAGATTGGGCCGAGGGACCAGAGAAGGATTCTGATGGGAAATGGCTTCAATGGG
GAATTGAACAAAGCACCATCCTAGCAACTCGGTTGCAAACCTTAGGCGTCGACTTAATTGACTGCAGTACGGGTG
GCAATTGGGCATCTCAAAAAATTCCAGTTGCCCCTGGATATCAGGTTAGTATATCCTTTTATTTCTGATGAGTGT
GTGCACTCATGAATATTCCCCAGGTTCCTTTCGCTGCCCAGTTGAAGAAAGCACTACCAGATCTTCTTGTTGGCA
CCGTGGGGCTCATAACTGAGGCTGAACAAGCTGAATCGTTCTTGAAAGAAGGAAAAGCTGATGTCATACTACTGG
CCAGGGCCCTCCTACGTGACCCTCACTGGCCCCTACACGCTGCTCGGAAGCTTGGAGTCAAGATCAAACCTGCAG
GACAGTATGAGCGCGCCTGGGCAGCGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail