Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003200
Gene name
Locationscaffold_01a:856106..857642
Strand+
Gene length (bp)1536
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 39 316 6.0E-76
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 38 314 3.0E-65
sp|Q93XX5|Y5713_ARATH PI-PLC X domain-containing protein At5g67130 OS=Arabidopsis thaliana GN=At5g67130 PE=1 SV=1 74 337 6.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003200
MRLIVATRLLTQLSFVLFPSVLSVLGAPNSGVGRRATVCNGHAELCDKSYGSVVSVGSHDSYAIAAGSSNVAANQ
DQNITTQLDDGIRMLQMQAHNENGVIKLCHTACVIFDGGTLQDYLTEVKSWLDANPNEVLSLLIVNSDSVPVSTY
DEVFKSVGLDTMGFIPPSLPLPALSWPTLGSMIDSGKRLVTFMDHEADGSVPYIIDEFTNIWETAFNVVDPTFDC
NVNRTNTQVETASQMYLINHFLDKIILGNPAPDIEKLNVTNAATGPGSLGAQVETCVAQNSKPPNFLLVDFYEFG
QGSVFQVAADLNGVQYTPTKPIATPVQGGASTSSSAQTSSRPLDNGDNPVLNFSWESILSLMSVVTAVLAGPQFL
L*
Coding >Agabi119p4|003200
ATGCGACTAATCGTCGCCACACGGCTACTAACACAACTTTCCTTTGTTCTTTTCCCATCAGTCCTTTCGGTGCTC
GGTGCTCCTAACTCAGGAGTTGGACGCCGTGCCACTGTGTGCAACGGACATGCTGAGCTTTGTGACAAAAGCTAC
GGATCGGTCGTCTCCGTCGGCTCCCATGATTCATATGCCATTGCTGCTGGTTCATCCAATGTCGCTGCCAATCAA
GATCAGAACATCACCACCCAGCTCGACGATGGAATTCGAATGCTTCAAATGCAGGCGCATAATGAGAATGGAGTC
ATTAAGCTTTGCCACACAGCTTGCGTCATTTTCGATGGTGGAACCCTCCAAGACTACCTCACCGAAGTGAAAAGC
TGGCTTGACGCGAACCCGAATGAAGTGCTTTCGCTCTTGATAGTTAATTCGGATAGTGTGCCCGTCTCTACGTAT
GACGAAGTCTTCAAGTCAGTGGGCCTTGACACTATGGGCTTTATCCCTCCATCCCTTCCACTGCCAGCTCTTTCT
TGGCCAACCCTAGGAAGCATGATTGATTCAGGAAAGCGTCTTGTCACCTTTATGGACCATGAAGCCGATGGTTCA
GTTCCCTACATCATTGATGAGTTTACCAACATTTGGGAAACAGCGTTCAATGTCGTTGATCCTACATTCGACTGC
AACGTTAACAGGACCAACACCCAGGTCGAGACCGCTAGTCAAATGTACCTCATCAACCACTTTCTTGATAAAATC
ATTCTTGGCAATCCTGCTCCCGACATTGAAAAGTTGAATGTGACGAATGCTGCTACGGGTCCTGGATCTCTCGGC
GCGCAAGTAGAAACATGCGTTGCGCAGAACTCTAAACCGCCCAACTTTTTGCTTGTCGACTTTTATGAATTCGGT
CAAGGATCAGTTTTCCAGGTTGCCGCCGACCTCAACGGCGTGCAGTACACCCCAACCAAACCCATCGCCACTCCA
GTTCAAGGAGGTGCATCGACATCATCTTCCGCCCAAACTTCCAGCAGACCGCTCGATAACGGAGACAATCCTGTA
CTCAACTTCTCCTGGGAGAGTATACTATCGTTGATGTCTGTGGTCACGGCAGTACTGGCAGGGCCTCAGTTTCTA
CTATAA
Transcript >Agabi119p4|003200
ATGCGACTAATCGTCGCCACACGGCTACTAACACAACTTTCCTTTGTTCTTTTCCCATCAGTCCTTTCGGTGCTC
GGTGCTCCTAACTCAGGAGTTGGACGCCGTGCCACTGTGTGCAACGGACATGCTGAGCTTTGTGACAAAAGCTAC
GGATCGGTCGTCTCCGTCGGCTCCCATGATTCATATGCCATTGCTGCTGGTTCATCCAATGTCGCTGCCAATCAA
GATCAGAACATCACCACCCAGCTCGACGATGGAATTCGAATGCTTCAAATGCAGGCGCATAATGAGAATGGAGTC
ATTAAGCTTTGCCACACAGCTTGCGTCATTTTCGATGGTGGAACCCTCCAAGACTACCTCACCGAAGTGAAAAGC
TGGCTTGACGCGAACCCGAATGAAGTGCTTTCGCTCTTGATAGTTAATTCGGATAGTGTGCCCGTCTCTACGTAT
GACGAAGTCTTCAAGTCAGTGGGCCTTGACACTATGGGCTTTATCCCTCCATCCCTTCCACTGCCAGCTCTTTCT
TGGCCAACCCTAGGAAGCATGATTGATTCAGGAAAGCGTCTTGTCACCTTTATGGACCATGAAGCCGATGGTTCA
GTTCCCTACATCATTGATGAGTTTACCAACATTTGGGAAACAGCGTTCAATGTCGTTGATCCTACATTCGACTGC
AACGTTAACAGGACCAACACCCAGGTCGAGACCGCTAGTCAAATGTACCTCATCAACCACTTTCTTGATAAAATC
ATTCTTGGCAATCCTGCTCCCGACATTGAAAAGTTGAATGTGACGAATGCTGCTACGGGTCCTGGATCTCTCGGC
GCGCAAGTAGAAACATGCGTTGCGCAGAACTCTAAACCGCCCAACTTTTTGCTTGTCGACTTTTATGAATTCGGT
CAAGGATCAGTTTTCCAGGTTGCCGCCGACCTCAACGGCGTGCAGTACACCCCAACCAAACCCATCGCCACTCCA
GTTCAAGGAGGTGCATCGACATCATCTTCCGCCCAAACTTCCAGCAGACCGCTCGATAACGGAGACAATCCTGTA
CTCAACTTCTCCTGGGAGAGTATACTATCGTTGATGTCTGTGGTCACGGCAGTACTGGCAGGGCCTCAGTTTCTA
CTATAA
Gene >Agabi119p4|003200
ATGCGACTAATCGTCGCCACACGGCTACTAACACAACTTTCCTTTGTTCTTTTCCCATCAGTCCTTTCGGTGCTC
GGTGCTCCTAACTCAGGAGTTGGACGCCGTGCCACTGTGTGCAACGGACATGCTGAGCTTTGTGACAAAAGCTAC
GGATCGGTCGTCTCCGTCGGCTCCCATGATTCATATGCCATTGCTGCTGGTTCATCCAATGGTAAGCTCAAAATT
GCTTCACCTCTGGTGTCAATAAGTTGAACAAGGAATATCTCTAGTCGCTGCCAATCAAGATCAGAACAGTGCGTT
CTCTATTTTATTCATCTTTAGCTCTTGGCTTACGCTAGAGAAATTATACAGTCACCACCCAGCTCGACGATGGAA
TTCGAATGCTTCAAATGCAGGCGCATAATGAGAATGGAGTCATTAAGCTTTGCCACACAGCTTGCGTGGGTTTAT
TAGCATTTTCGGCGTGAACTGTGGTCCCTAAACTTCAAATACAGGTCATTTTCGATGGTGGAACCCTCCAAGACT
ACCTCACCGAAGGTGAGCTATTGTGATTATGCAACGCCTCACATGCCTCATTATTGTCTTTGACAGTGAAAAGCT
GGCTTGACGCGAACCCGAATGAAGGTGCGATACGCTGATATATGTGCGAGTCGAGATGAAAATTGACCTTGGTTG
AAGTGCTTTCGCTCTTGATAGTTAATTCGGATAGTGTGCCCGTCTCTACGTATGACGAAGTCTTCAAGTCAGTGG
GCCTTGACACTATGGGCTTTATCCCTCCATCCCTTCCACTGCCAGCTCTTTCTTGGCCAACCCTAGGAAGCATGA
TTGATTCAGGAAAGCGTCTTGTCACCTTTATGGACCATGAAGCCGATGGTTCAGTTCCCTACATCATTGATGGTT
TGTGATCTTCACTTCTGATTGTCTTCGGAGTTTTTTTTCCTTACAATTCGCAACAGAGTTTACCAACATTTGGGA
AACAGCGTTCAATGTCGTTGATCCTACATTCGACTGCAACGTTAACAGGACCAACACCCAGGTCGAGACCGCTAG
TCAAATGTACCTCATCAACCACTTTCTTGATAAAATCATTCTTGGCAATCCTGCTCCCGACATTGAAAAGTTGAA
TGTGACGAATGCTGCTACGGGTCCTGGATCTCTCGGCGCGCAAGTAGAAACATGCGTTGCGCAGAACTCTAAACC
GCCCAACTTTTTGCTTGTCGACGTAAGTACTTTTCTCTTTTGCGTTCTAGTTTTGATTAGAACTCATTTTGAAAC
TTTGTCTTTGGATAGTTTTATGAATTCGGTCAAGGATCAGTTTTCCAGGTTGCCGCCGACCTCAACGGCGTGCAG
TACACCCCAACCAAACCCATCGCCACTCCAGTTCAAGGAGGTGCATCGACATCATCTTCCGCCCAAACTTCCAGC
AGACCGCTCGATAACGGAGACAATCCTGTACTCAACTTCTCCTGGGAGAGTATACTATCGTTGATGTCTGTGGTC
ACGGCAGTACTGGCAGGGCCTCAGTTTCTACTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail