Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003090
Gene name
Locationscaffold_01a:833561..834967
Strand+
Gene length (bp)1406
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05739 SNARE SNARE domain 1.3E-11 304 356
PF11416 Syntaxin-5_N Syntaxin-5 N-terminal, Sly1p-binding domain 1.4E-06 23 40

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13644|SED5_SCHPO Integral membrane protein sed5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sed5 PE=3 SV=1 24 359 8.0E-85
sp|Q08851|STX5_RAT Syntaxin-5 OS=Rattus norvegicus GN=Stx5 PE=1 SV=2 5 343 7.0E-74
sp|Q8K1E0|STX5_MOUSE Syntaxin-5 OS=Mus musculus GN=Stx5 PE=1 SV=3 15 343 3.0E-73
sp|Q08DB5|STX5_BOVIN Syntaxin-5 OS=Bos taurus GN=STX5 PE=2 SV=1 23 343 6.0E-72
sp|Q13190|STX5_HUMAN Syntaxin-5 OS=Homo sapiens GN=STX5 PE=1 SV=2 23 343 9.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13644|SED5_SCHPO Integral membrane protein sed5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sed5 PE=3 SV=1 24 359 8.0E-85
sp|Q08851|STX5_RAT Syntaxin-5 OS=Rattus norvegicus GN=Stx5 PE=1 SV=2 5 343 7.0E-74
sp|Q8K1E0|STX5_MOUSE Syntaxin-5 OS=Mus musculus GN=Stx5 PE=1 SV=3 15 343 3.0E-73
sp|Q08DB5|STX5_BOVIN Syntaxin-5 OS=Bos taurus GN=STX5 PE=2 SV=1 23 343 6.0E-72
sp|Q13190|STX5_HUMAN Syntaxin-5 OS=Homo sapiens GN=STX5 PE=1 SV=2 23 343 9.0E-72
sp|Q24509|STX5_DROME Syntaxin-5 OS=Drosophila melanogaster GN=Syx5 PE=2 SV=2 24 344 3.0E-64
sp|Q9LK09|SYP32_ARATH Syntaxin-32 OS=Arabidopsis thaliana GN=SYP32 PE=2 SV=1 27 357 4.0E-52
sp|Q20797|STX5_CAEEL Putative syntaxin-5 OS=Caenorhabditis elegans GN=syx-5 PE=3 SV=1 22 343 2.0E-49
sp|Q01590|SED5_YEAST Integral membrane protein SED5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SED5 PE=1 SV=1 24 359 5.0E-46
sp|Q9FFK1|SYP31_ARATH Syntaxin-31 OS=Arabidopsis thaliana GN=SYP31 PE=1 SV=1 60 357 1.0E-40
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 339 358 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003090
MQGTAPPSAPYLYHIPSLYNTLSMPIQDRTNEFRACVDSIHHRSVSRGVEQKQRLLQKDRSSSKSEFSRLASAIG
KDINNTTLKLNKLAQLAKRKTLFDDRPVEISELTYIIKQDIAHLNKQIASLQAYVKQRNAGNTSSVENKQVEEHT
NNVVMLLQSKLANTSVTFKDVLEVRTQNMKESRTRTEQFMYSATSAATQPPSNSVLYNSSRNDPMGDGTANSFDF
KGKGRATPKNDELSLDLNAVEGGSANGHADGAFMQMQLVEQQDTYIQQRSTAIESIETTIAELGQIFTQLANMVA
EQRETVQRIDENVLDIESNITSAHGELSKYLAGMMSNRWLMLKMFGVLIVFFLIFILVS*
Coding >Agabi119p4|003090
ATGCAGGGCACCGCTCCTCCTTCTGCTCCATATCTATATCATATTCCCTCTCTCTACAATACCCTTAGTATGCCT
ATTCAAGACCGCACAAATGAATTTAGAGCATGTGTAGACTCTATTCATCACCGCTCTGTCTCGCGTGGCGTAGAA
CAAAAGCAGCGACTTCTGCAGAAGGACAGATCCTCCTCGAAGAGCGAATTTTCTCGTTTGGCTTCCGCGATTGGA
AAAGACATCAATAATACCACTCTGAAACTCAACAAACTTGCTCAGCTTGCAAAACGAAAAACCTTGTTCGACGAT
CGGCCTGTAGAAATTAGTGAATTAACATACATCATAAAGCAAGATATTGCCCACCTAAACAAACAAATTGCGTCT
CTGCAGGCATATGTCAAGCAGCGCAATGCCGGCAATACTTCGTCGGTAGAGAACAAACAAGTTGAAGAGCATACG
AATAATGTCGTCATGCTACTGCAGAGCAAGCTTGCAAACACCAGCGTAACATTCAAGGACGTGCTAGAAGTACGG
ACACAAAACATGAAGGAATCGAGAACACGGACAGAACAATTTATGTATAGCGCCACATCGGCAGCTACACAACCA
CCCTCTAATTCAGTATTGTACAATTCTTCTAGAAATGACCCAATGGGCGACGGTACCGCCAATAGTTTCGATTTC
AAGGGTAAAGGCCGGGCCACACCCAAAAATGACGAACTATCTCTCGATTTGAATGCGGTGGAGGGGGGGAGCGCC
AACGGGCATGCAGATGGTGCATTCATGCAGATGCAGCTAGTTGAACAACAGGATACATACATTCAACAACGCTCG
ACCGCTATTGAATCTATTGAAACCACCATTGCCGAATTGGGCCAAATTTTCACTCAGCTTGCTAACATGGTAGCT
GAACAACGAGAAACAGTCCAGCGAATCGACGAAAACGTCCTTGATATTGAGAGTAACATAACCTCTGCCCATGGA
GAGCTTTCGAAATATCTGGCAGGTATGATGAGTAACCGATGGCTCATGTTAAAAATGTTCGGCGTCCTCATTGTC
TTCTTCCTCATCTTCATTTTGGTTTCATAA
Transcript >Agabi119p4|003090
ATGCAGGGCACCGCTCCTCCTTCTGCTCCATATCTATATCATATTCCCTCTCTCTACAATACCCTTAGTATGCCT
ATTCAAGACCGCACAAATGAATTTAGAGCATGTGTAGACTCTATTCATCACCGCTCTGTCTCGCGTGGCGTAGAA
CAAAAGCAGCGACTTCTGCAGAAGGACAGATCCTCCTCGAAGAGCGAATTTTCTCGTTTGGCTTCCGCGATTGGA
AAAGACATCAATAATACCACTCTGAAACTCAACAAACTTGCTCAGCTTGCAAAACGAAAAACCTTGTTCGACGAT
CGGCCTGTAGAAATTAGTGAATTAACATACATCATAAAGCAAGATATTGCCCACCTAAACAAACAAATTGCGTCT
CTGCAGGCATATGTCAAGCAGCGCAATGCCGGCAATACTTCGTCGGTAGAGAACAAACAAGTTGAAGAGCATACG
AATAATGTCGTCATGCTACTGCAGAGCAAGCTTGCAAACACCAGCGTAACATTCAAGGACGTGCTAGAAGTACGG
ACACAAAACATGAAGGAATCGAGAACACGGACAGAACAATTTATGTATAGCGCCACATCGGCAGCTACACAACCA
CCCTCTAATTCAGTATTGTACAATTCTTCTAGAAATGACCCAATGGGCGACGGTACCGCCAATAGTTTCGATTTC
AAGGGTAAAGGCCGGGCCACACCCAAAAATGACGAACTATCTCTCGATTTGAATGCGGTGGAGGGGGGGAGCGCC
AACGGGCATGCAGATGGTGCATTCATGCAGATGCAGCTAGTTGAACAACAGGATACATACATTCAACAACGCTCG
ACCGCTATTGAATCTATTGAAACCACCATTGCCGAATTGGGCCAAATTTTCACTCAGCTTGCTAACATGGTAGCT
GAACAACGAGAAACAGTCCAGCGAATCGACGAAAACGTCCTTGATATTGAGAGTAACATAACCTCTGCCCATGGA
GAGCTTTCGAAATATCTGGCAGGTATGATGAGTAACCGATGGCTCATGTTAAAAATGTTCGGCGTCCTCATTGTC
TTCTTCCTCATCTTCATTTTGGTTTCATAA
Gene >Agabi119p4|003090
ATGCAGGGCACCGCTCCTCCTTCTGCTCCATATCTATATCATATTCCCTCTCTCTACAATACCCTTAGTATGCCT
ATTCAAGACCGCACAAATGAATTTAGAGCATGTGTAGACTCTATTCATCACCGCTCTGTCTCGCGTGGCGTAGAA
CAAAAGCAGCGACTTCTGCAGAAGGACAGATCCTCCTCGAAGAGCGAATTTTCTCGTTTGGCTTCCGCGATTGGA
AAAGACATCAATAATACCACTCTGAAACTCAACAAACTTGCTCAGCGTACGCTTCTGGAGCTTCTGGCCGCATCC
GCAGGTTCACTCACATTTCGCTCCCTATAGTTGCAAAACGAAAAACCTTGTTCGACGATCGGCCTGTAGAAATTA
GTGTATGTCCCGCCACGCATGAAAATCGTTCCGGTGATATGGAAGACGTCCCCACAGGAATTAACATACATCATA
AAGCAAGATATTGCCCACCTAAACAAACAAATTGCGTCTCTGCAGGCATATGTCAAGCAGCGCAATGCCGGCAAT
ACTTCGTCGGTAGAGAACAAACAAGTTGAAGAGCATACGAATAATGTCGTCATGCTACTGCAGAGCAAGCTTGCA
AACACCAGCGTAACATTCAAGGACGTGCTAGAAGTACGGACACAAGTGCGTTGCATGTTTGCTAGTATCTCTGGT
TTTTTTCCTTCTAATGCGACATACCCTAGAACATGAAGGAATCGAGAACACGGACAGAACAATTTATGTATAGCG
CCACATCGGCAGCTACACAACCACCCTCTAGTAGGCACCCCTTTTCACCCAGGTTGGAAAATGCTCATATATTCC
CAGATTCAGTATTGTACAATTCTTCTAGAAATGACCCAATGGGCGACGGTACCGCCAATAGTTTCGATTTCAAGG
GTAAAGGCCGGGCCACACCCAAAAATGACGAACTATCTCTCGATTTGAATGCGGTGGAGGGGGGGAGCGCCAACG
GGCATGCAGATGGTGCATTCATGCAGATGCAGCTAGTTGAACAACAGGTATGCTTCTCTCCTCGAGACACTTCCG
TCCTGACGGTGTTCTTGGCTACAGGATACATACATTCAACAACGCTCGACCGCTATTGAATCTATTGAAACCACC
ATTGCCGAATTGGGCCAAATTTTCACTCAGCTTGCTAACATGGTAGCTGAACAACGAGAAACAGTCCAGCGAATC
GACGAAAACGTCCTTGATATTGAGAGTAACATAACCTCTGCCCATGGAGAGCTTTCGAAATATCTGGCAGGTATG
ATGAGTAACCGATGGCTCATGTTAAAAATGTTCGGCGTCCTCATTGTCTTCGTAAGTTTCTCATCGTCTTGTAAT
CCAGGCGTGAATCTAATATGCTTCTTCAGTTCCTCATCTTCATTTTGGTTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail