Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|003070
Gene name
Locationscaffold_01a:829079..831373
Strand-
Gene length (bp)2294
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.6E-08 3 62
PF00023 Ank Ankyrin repeat 2.9E-03 36 62
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.9E-05 170 188
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.7E-01 397 414
PF13606 Ank_3 Ankyrin repeat 3.0E-03 36 62

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|003070
MAFPLLKACSEGNLHVVSDLLHGSNPVDIEFRDESGSTPLIEAVKNGHVNIIHTLLEKGADPSNGSPEQHTTDQV
ILGLLAQAKNKPLQDGVSGPESSYLRDGSDDSQKPFYPPPPPDAYPYYPTINPSLSTVPDGGVYYPPPLPPHMGG
NHSPGGPHHLPPPEVARMIPCRYYPACRYGPSCIFLHPPQGYYPNGAPPPAPYPHYDPMGAPPFSPNFYPPPTYQ
QANGPLPMTPLSPPPGPPHIVHARSTSEIVSPTQGHFSPNGVSPPVPYGPMSPSYPHSAPMPVPLSGPPVPPLHH
QPQPQLPPPGPQSPTNFSPSPVGPFNVQPDGPAMYPQQQPSLSNGNVSFAPEVDGMPKPQPGAEGFVNGVPHPHT
RDVPMHARRSSRRASFGKPKPPCLFFPTGRCKNGDDCRFPHIMPDGTSASTNHHTPFYAGRGGGPRQPRGQFLHN
GLEEKFNNMNIRDESQIQQNGVDVASKSLNTANDNGPVVNTRPRFPPSGKHHQHHPHHGFNSQHNHYNGKLQKLN
VQGNMKQRVPNADDFPVLAGTITPPSKSPLTVNGPTAAQILQAPAPMRKEVSSLINGKEASTRGTTPERSRSPSI
KDSPQYQDNGVPDDNVSSEPPANKLPVSFAAAATAAKGSAAPDIAKEVSVSA*
Coding >Agabi119p4|003070
ATGGCCTTTCCTCTCCTCAAGGCTTGTTCTGAGGGCAACCTCCACGTCGTCAGCGATCTCCTCCACGGCTCCAAT
CCAGTTGATATTGAATTTAGAGACGAGTCCGGGTCCACTCCCCTCATTGAGGCCGTCAAAAATGGTCACGTCAAC
ATCATCCATACTCTTCTCGAAAAAGGCGCCGATCCGTCTAACGGTTCTCCTGAGCAGCACACGACTGACCAGGTC
ATCCTAGGCCTACTGGCACAGGCAAAAAACAAACCTCTCCAGGATGGCGTCTCTGGTCCCGAATCATCGTACCTC
CGTGATGGGAGTGACGATTCCCAAAAGCCTTTCTACCCTCCCCCTCCTCCAGACGCATACCCTTATTATCCCACT
ATCAATCCTTCCCTTTCTACTGTCCCCGATGGAGGTGTCTATTACCCTCCTCCCCTTCCTCCGCACATGGGTGGA
AACCACTCACCAGGGGGTCCACACCATCTTCCTCCCCCCGAGGTAGCTCGTATGATTCCATGTCGATACTACCCC
GCCTGTCGTTATGGTCCTTCGTGCATTTTTTTGCATCCCCCTCAAGGTTATTATCCCAACGGTGCCCCGCCCCCT
GCACCTTACCCTCATTATGACCCCATGGGTGCTCCTCCCTTCTCTCCCAACTTTTACCCGCCGCCCACCTACCAG
CAGGCTAATGGTCCGCTTCCCATGACGCCTCTTTCCCCACCACCTGGCCCTCCCCATATCGTACACGCTAGGTCA
ACATCAGAAATTGTCTCGCCTACCCAAGGGCACTTTAGTCCGAATGGGGTTTCGCCTCCCGTACCGTATGGACCC
ATGTCACCTTCATACCCTCATTCTGCGCCAATGCCAGTCCCACTTTCGGGTCCCCCCGTACCCCCACTCCACCAT
CAACCACAGCCTCAACTTCCCCCTCCCGGGCCCCAGTCACCTACGAATTTTTCGCCTTCGCCCGTAGGTCCCTTC
AATGTTCAACCGGATGGTCCCGCCATGTATCCTCAACAGCAACCATCATTGTCCAATGGGAACGTAAGCTTTGCG
CCGGAGGTTGATGGCATGCCCAAGCCTCAACCTGGGGCCGAAGGTTTTGTTAACGGTGTTCCTCATCCTCATACT
CGCGATGTACCCATGCATGCTCGTCGGAGTAGTCGACGCGCTTCCTTCGGGAAGCCTAAACCTCCTTGTCTTTTC
TTCCCCACCGGGAGGTGTAAAAATGGTGACGACTGTCGGTTCCCCCATATCATGCCCGACGGCACTAGTGCATCT
ACAAATCATCATACACCTTTCTATGCAGGGAGGGGAGGTGGTCCCAGACAGCCACGTGGTCAGTTCCTACATAAT
GGCTTGGAAGAAAAGTTCAATAATATGAACATTCGAGATGAATCCCAGATCCAACAAAATGGCGTCGATGTTGCG
TCAAAATCTTTGAACACCGCCAATGACAATGGACCAGTTGTCAATACTCGTCCTCGATTTCCGCCTAGTGGTAAA
CACCATCAACACCACCCTCATCACGGCTTCAACTCCCAGCACAACCATTATAACGGAAAGTTGCAAAAATTGAAT
GTGCAAGGGAACATGAAGCAACGTGTGCCAAATGCTGACGATTTCCCTGTTCTCGCTGGAACCATCACACCACCT
TCGAAGAGCCCCTTGACAGTAAATGGACCGACAGCTGCTCAAATCCTACAAGCACCAGCACCTATGAGGAAAGAG
GTCTCGTCGCTTATCAATGGAAAAGAAGCTAGCACGCGTGGGACAACTCCTGAACGATCTCGGTCACCTAGCATA
AAGGATTCCCCGCAATATCAGGACAACGGAGTTCCTGATGATAATGTTTCTTCTGAGCCCCCCGCCAATAAACTT
CCTGTCTCATTTGCGGCTGCAGCTACAGCAGCCAAGGGATCTGCAGCACCAGATATTGCAAAAGAGGTGTCTGTC
TCTGCCTAG
Transcript >Agabi119p4|003070
ATGGCCTTTCCTCTCCTCAAGGCTTGTTCTGAGGGCAACCTCCACGTCGTCAGCGATCTCCTCCACGGCTCCAAT
CCAGTTGATATTGAATTTAGAGACGAGTCCGGGTCCACTCCCCTCATTGAGGCCGTCAAAAATGGTCACGTCAAC
ATCATCCATACTCTTCTCGAAAAAGGCGCCGATCCGTCTAACGGTTCTCCTGAGCAGCACACGACTGACCAGGTC
ATCCTAGGCCTACTGGCACAGGCAAAAAACAAACCTCTCCAGGATGGCGTCTCTGGTCCCGAATCATCGTACCTC
CGTGATGGGAGTGACGATTCCCAAAAGCCTTTCTACCCTCCCCCTCCTCCAGACGCATACCCTTATTATCCCACT
ATCAATCCTTCCCTTTCTACTGTCCCCGATGGAGGTGTCTATTACCCTCCTCCCCTTCCTCCGCACATGGGTGGA
AACCACTCACCAGGGGGTCCACACCATCTTCCTCCCCCCGAGGTAGCTCGTATGATTCCATGTCGATACTACCCC
GCCTGTCGTTATGGTCCTTCGTGCATTTTTTTGCATCCCCCTCAAGGTTATTATCCCAACGGTGCCCCGCCCCCT
GCACCTTACCCTCATTATGACCCCATGGGTGCTCCTCCCTTCTCTCCCAACTTTTACCCGCCGCCCACCTACCAG
CAGGCTAATGGTCCGCTTCCCATGACGCCTCTTTCCCCACCACCTGGCCCTCCCCATATCGTACACGCTAGGTCA
ACATCAGAAATTGTCTCGCCTACCCAAGGGCACTTTAGTCCGAATGGGGTTTCGCCTCCCGTACCGTATGGACCC
ATGTCACCTTCATACCCTCATTCTGCGCCAATGCCAGTCCCACTTTCGGGTCCCCCCGTACCCCCACTCCACCAT
CAACCACAGCCTCAACTTCCCCCTCCCGGGCCCCAGTCACCTACGAATTTTTCGCCTTCGCCCGTAGGTCCCTTC
AATGTTCAACCGGATGGTCCCGCCATGTATCCTCAACAGCAACCATCATTGTCCAATGGGAACGTAAGCTTTGCG
CCGGAGGTTGATGGCATGCCCAAGCCTCAACCTGGGGCCGAAGGTTTTGTTAACGGTGTTCCTCATCCTCATACT
CGCGATGTACCCATGCATGCTCGTCGGAGTAGTCGACGCGCTTCCTTCGGGAAGCCTAAACCTCCTTGTCTTTTC
TTCCCCACCGGGAGGTGTAAAAATGGTGACGACTGTCGGTTCCCCCATATCATGCCCGACGGCACTAGTGCATCT
ACAAATCATCATACACCTTTCTATGCAGGGAGGGGAGGTGGTCCCAGACAGCCACGTGGTCAGTTCCTACATAAT
GGCTTGGAAGAAAAGTTCAATAATATGAACATTCGAGATGAATCCCAGATCCAACAAAATGGCGTCGATGTTGCG
TCAAAATCTTTGAACACCGCCAATGACAATGGACCAGTTGTCAATACTCGTCCTCGATTTCCGCCTAGTGGTAAA
CACCATCAACACCACCCTCATCACGGCTTCAACTCCCAGCACAACCATTATAACGGAAAGTTGCAAAAATTGAAT
GTGCAAGGGAACATGAAGCAACGTGTGCCAAATGCTGACGATTTCCCTGTTCTCGCTGGAACCATCACACCACCT
TCGAAGAGCCCCTTGACAGTAAATGGACCGACAGCTGCTCAAATCCTACAAGCACCAGCACCTATGAGGAAAGAG
GTCTCGTCGCTTATCAATGGAAAAGAAGCTAGCACGCGTGGGACAACTCCTGAACGATCTCGGTCACCTAGCATA
AAGGATTCCCCGCAATATCAGGACAACGGAGTTCCTGATGATAATGTTTCTTCTGAGCCCCCCGCCAATAAACTT
CCTGTCTCATTTGCGGCTGCAGCTACAGCAGCCAAGGGATCTGCAGCACCAGATATTGCAAAAGAGGTGTCTGTC
TCTGCCTAG
Gene >Agabi119p4|003070
ATGGCCTTTCCTCTCCTCAAGGCTTGTTCTGAGGGCAACCTCCACGTCGTCAGCGATCTCCTCCACGGCTCCAAT
CCAGTTGATATTGAATTTAGAGGTTCGTCATCGCTTTCCTTTCCTTGTATCCTTCTCACTGTCCTCGCCACTTTT
GCAGACGAGTCCGGGTCCACTCCCCTCATTGAGGCCGTCAAAAATGGTCACGTCAACATCATCCATACTCTTCTC
GAAAAAGGTATGTCTCTGACTCATTCCTCATGTGAGATGTTCCCTGATCACCTTCCAAACCCAGGCGCCGATCCG
TCTAACGGTTCTCCTGAGCAGCACACGACTGACCAGGTCATCCTAGGCCTACTGGCACAGGCAAAAAACAAACCT
CTCCAGGATGGCGTCTCTGGTCCCGAATCATCGTACCTCCGTGATGGGAGTGACGATTCCCAAAAGCCTTTCTAC
CCTCCCCCTCCTCCAGACGCATACCCTTATTATCCCACTATCAATCCTTCCCTTTCTACTGTCCCCGATGGAGGT
GTCTATTACCCTCCTCCCCTTCCTCCGCACATGGGTGGAAACCACTCACCAGGGGGTCCACACCATCTTCCTCCC
CCCGAGGTAGCTCGTATGATTCCATGTCGATACTACCCCGCCTGTCGTTATGGTCCTTCGTGCATTTTTTTGCAT
CCCCCTCAAGGTTATTATCCCAACGGTGCCCCGCCCCCTGCACCTTACCCTCATTATGACCCCATGGGTGCTCCT
CCCTTCTCTCCCAACTTTTACCCGCCGCCCACCTACCAGCAGGCTAATGGTCCGCTTCCCATGACGCCTCTTTCC
CCACCACCTGGCCCTCCCCATATCGTACACGCTAGGTCAACATCAGAAATTGTCTCGCCTACCCAAGGGCACTTT
AGTCCGAATGGGGTTTCGCCTCCCGTACCGTATGGACCCATGTCACCTTCATACCCTCATTCTGCGCCAATGCCA
GTCCCACTTTCGGGTCCCCCCGTACCCCCACTCCACCATCAACCACAGCCTCAACTTCCCCCTCCCGGGCCCCAG
TCACCTACGAATTTTTCGCCTTCGCCCGTAGGTCCCTTCAATGTTCAACCGGATGGTCCCGCCATGTATCCTCAA
CAGCAACCATCATTGTCCAATGGGAACGTAAGCTTTGCGCCGGAGGTTGATGGCATGCCCAAGCCTCAACCTGGG
GCCGAAGGTTTTGTTAACGGTGTTCCTCATCCTCATACTCGCGATGTACCCATGCATGCTCGTCGGAGTAGTCGA
CGCGCTTCCTTCGGGAAGCCTAAACCTCCTTGTCTTTTCTTCCCCACCGGGAGGTGTAAAAATGGGTACGTGATT
CCCCGATATAGAACAGTTTCTTTTTTTGCCAATATGCCTTCCAAAAATGCATTTTTTTACTGATTGCTGAATTTA
CTACACAGTGACGACTGTCGGTTCCCCCATATCATGCCCGACGGCACTAGTGCATCTACAAATCATCATACACCT
TTCTATGCAGGGAGGGGAGGTGGTCCCAGACAGCCACGTGGTCAGTTCCTACATAATGGCTTGGAAGAAAAGTTC
AATAATATGAACATTCGAGATGTGAGGGACCAGCCGTAGCGCTTTTCTTTTCTTTTACGTACCATGTGTGTTGAT
TGTATGATTTAATTCAGGAATCCCAGATCCAACAAAATGGCGTCGATGTTGCGTCAAAATCTTTGAACACCGCCA
ATGACAATGGACCAGTTGTCAATACTCGTCCTCGATTTCCGCCTAGTGGTAAACACCATCAACACCACCCTCATC
ACGGCTTCAACTCCCAGCACAACCATTATAACGGAAAGTTGCAAAAATTGAATGTGCAAGGGAACATGAAGCAAC
GTGTGCCAAATGCTGACGATTTCCCTGTTCTCGCTGGAACCATCACACCACCTTCGAAGAGCCCCTTGACAGTAA
ATGGACCGACAGCTGCTCAAATCCTACAAGCACCAGCACCTATGAGGAAAGAGGTCTCGTCGCTTATCAATGGAA
AAGAAGCTAGCACGCGTGGGACAACTCCTGAACGATCTCGGTCACCTAGCATAAAGGTAAAATCGCCTCAGTTAA
AAGGTGTAACAAGCTGCTGAACCTCCGCTTGTGACCAGGATTCCCCGCAATATCAGGACAACGGAGTTCCTGATG
ATAATGTTTCTTCTGAGCCCCCCGCCAATAAACTTCCTGTCTCATTTGCGGCTGCAGCTACAGCAGCCAAGGGAT
CTGCAGCACCAGATATTGCAAAAGAGGTGTCTGTCTCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail