Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|002760
Gene name
Locationscaffold_01a:753434..755373
Strand+
Gene length (bp)1939
Transcript length (bp)1173
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 2.6E-51 111 358
PF00734 CBM_1 Fungal cellulose binding domain 1.0E-11 20 48

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 4 376 3.0E-109
sp|Q04469|GUN1_CRYFL Endoglucanase 1 OS=Cryptococcus flavus GN=CMC1 PE=2 SV=1 78 390 4.0E-96
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 1 376 8.0E-57
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 2 375 1.0E-51
sp|P58599|GUN_RALSO Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) GN=egl PE=3 SV=1 83 379 1.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 4 376 3.0E-109
sp|Q04469|GUN1_CRYFL Endoglucanase 1 OS=Cryptococcus flavus GN=CMC1 PE=2 SV=1 78 390 4.0E-96
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 1 376 8.0E-57
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 2 375 1.0E-51
sp|P58599|GUN_RALSO Endoglucanase OS=Ralstonia solanacearum (strain GMI1000) GN=egl PE=3 SV=1 83 379 1.0E-47
sp|P17974|GUN_RALSL Endoglucanase OS=Ralstonia solanacearum GN=egl PE=1 SV=2 83 379 5.0E-47
sp|Q1HFS8|EGLB_EMENI Endo-beta-1,4-glucanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglB PE=1 SV=1 106 371 2.0E-41
sp|A1DME8|EGLB_NEOFI Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglB PE=3 SV=1 106 376 3.0E-39
sp|Q5BDU5|EGLA_EMENI Endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglA PE=1 SV=1 73 371 8.0E-39
sp|P23044|GUN_ROBSP Endoglucanase 1 OS=Robillarda sp. (strain Y-20) GN=eg 1 PE=1 SV=2 113 361 2.0E-37
sp|Q96WQ8|EGLB_ASPKW Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) GN=eglB PE=3 SV=1 106 376 1.0E-35
sp|Q2UPQ4|EGLB_ASPOR Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglB PE=3 SV=1 106 375 5.0E-34
sp|B8MW97|EGLB_ASPFN probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=eglB PE=3 SV=1 106 375 5.0E-34
sp|O74706|EGLB_ASPNG Endo-beta-1,4-glucanase B OS=Aspergillus niger GN=eglB PE=1 SV=1 106 376 8.0E-33
sp|A2QPC3|EGLB_ASPNC Probable endo-beta-1,4-glucanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglB PE=3 SV=1 106 376 8.0E-33
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 11 80 2.0E-12
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 14 69 5.0E-11
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 3 64 8.0E-11
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 5 159 2.0E-10
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 1 63 2.0E-09
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 1 222 3.0E-09
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 14 52 8.0E-09
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 21 91 2.0E-08
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 21 91 2.0E-08
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 1 54 4.0E-08
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 1 54 4.0E-08
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 14 52 5.0E-08
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 14 54 5.0E-08
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 1 54 6.0E-08
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 8 58 1.0E-07
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 5 52 1.0E-07
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 5 243 2.0E-07
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 5 243 2.0E-07
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 21 60 3.0E-07
sp|P10477|CELE_CLOTH Cellulase/esterase CelE OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=celE PE=1 SV=2 116 284 3.0E-07
sp|Q0CMT2|CBHB_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhB PE=3 SV=1 20 52 5.0E-07
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 3 56 8.0E-07
sp|P23661|GUNB_RUMAL Endoglucanase B OS=Ruminococcus albus GN=celB PE=3 SV=1 118 285 8.0E-07
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 21 68 1.0E-06
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 20 52 1.0E-06
sp|P25472|GUND_CLOCE Endoglucanase D OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=celCCD PE=3 SV=1 83 284 2.0E-06
sp|P79046|XYN1_HUMGT Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea GN=xyn1 PE=2 SV=1 17 52 2.0E-06
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 14 51 2.0E-06
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 20 52 2.0E-06
sp|Q4WM08|CBHB_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhB PE=1 SV=1 20 52 3.0E-06
sp|B0Y8K2|CBHB_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhB PE=3 SV=1 20 52 3.0E-06
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 21 82 3.0E-06
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 19 55 4.0E-06
sp|Q5ZNB1|XYND_TALFU Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus GN=xynD PE=1 SV=1 20 52 4.0E-06
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 20 52 4.0E-06
sp|P13860|GUX1_PHACH Exoglucanase 1 OS=Phanerochaete chrysosporium GN=CBH1 PE=2 SV=1 19 51 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0005576 extracellular region Yes
GO:0030248 cellulose binding Yes
GO:0003824 catalytic activity No
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0030247 polysaccharide binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|002760
MRSILVALFAVSCVLAQQPEWAQCGGIGWTGGTTCVSGCVCTPLNDYYSQCLRGTATTTTTTSSSGPTPTTAPSP
GRLPFLGGINMAGYDFTVFTDGSFNGTGQDPPVQQFSHFASQGVNVFRIPFAWQLMTPTVGGTIDSNFFRRYDAT
VEAAKSSGSDPYIILDLHNYARWNGRIIGQGGPTNEQYASLWSQLAAKYKENQKIIFGIMNEPHDVPNIAGWVTS
VQTVVNAIRAAGATNQYILIPGSSWSSAQALPNEAGPQLLTVTDPSGGTDRLIFDVHKYLDSDNSGTHIECTTDN
VQVMQTLVNWLRANGNRQAILSETGAGNTQSCFTAFKSELSFVKSNSDSITGFAAWSAGSFNTMYELTLTPNPDG
SDQPLWTQAVVPNLP*
Coding >Agabi119p4|002760
ATGAGATCAATTCTTGTTGCTCTATTCGCCGTCTCGTGTGTTCTTGCCCAACAGCCAGAATGGGCTCAGTGTGGT
GGCATTGGTTGGACTGGCGGAACGACTTGTGTTTCGGGTTGCGTTTGCACTCCTTTGAATGACTACTACTCACAG
TGTCTCCGTGGGACTGCTACCACAACCACAACCACAAGCTCATCAGGACCGACTCCTACAACTGCACCTAGTCCA
GGACGCCTCCCATTTTTGGGCGGTATCAATATGGCTGGCTATGACTTCACAGTATTTACGGACGGTTCCTTCAAT
GGCACTGGACAAGATCCTCCCGTACAACAATTTTCTCACTTTGCGTCGCAAGGTGTTAATGTTTTCCGCATCCCT
TTCGCCTGGCAGTTGATGACACCCACCGTTGGTGGTACTATCGACAGTAACTTCTTCAGACGCTATGATGCCACC
GTTGAAGCTGCCAAGAGCTCTGGTTCCGATCCATATATCATCCTTGACCTACATAATTATGCTCGCTGGAATGGC
CGAATTATTGGCCAGGGAGGTCCAACCAATGAACAATATGCCAGCCTGTGGTCTCAGCTCGCCGCTAAGTACAAG
GAAAATCAGAAAATTATCTTTGGTATCATGAACGAGCCTCACGACGTCCCCAATATCGCTGGCTGGGTCACTTCT
GTACAAACCGTTGTCAACGCCATCCGCGCTGCTGGCGCTACTAATCAATACATCCTCATCCCAGGTTCATCATGG
TCTAGTGCACAAGCACTACCTAATGAAGCCGGACCTCAGCTTCTTACTGTTACCGATCCCTCTGGTGGAACCGAT
AGGCTGATCTTCGACGTCCACAAATACCTGGATTCTGACAACAGTGGGACCCACATTGAATGTACCACGGATAAT
GTTCAAGTCATGCAAACGCTGGTCAATTGGCTACGAGCCAATGGCAATCGGCAAGCAATTCTTAGTGAGACTGGT
GCAGGAAACACCCAATCCTGCTTCACTGCCTTTAAGTCCGAGCTCTCCTTCGTGAAGAGCAACTCGGATTCTATT
ACTGGATTTGCTGCATGGAGTGCCGGCAGCTTTAACACGATGTATGAGTTGACCCTCACTCCCAATCCTGACGGT
TCGGATCAGCCTTTGTGGACTCAGGCGGTTGTTCCCAACCTTCCTTGA
Transcript >Agabi119p4|002760
ATGAGATCAATTCTTGTTGCTCTATTCGCCGTCTCGTGTGTTCTTGCCCAACAGCCAGAATGGGCTCAGTGTGGT
GGCATTGGTTGGACTGGCGGAACGACTTGTGTTTCGGGTTGCGTTTGCACTCCTTTGAATGACTACTACTCACAG
TGTCTCCGTGGGACTGCTACCACAACCACAACCACAAGCTCATCAGGACCGACTCCTACAACTGCACCTAGTCCA
GGACGCCTCCCATTTTTGGGCGGTATCAATATGGCTGGCTATGACTTCACAGTATTTACGGACGGTTCCTTCAAT
GGCACTGGACAAGATCCTCCCGTACAACAATTTTCTCACTTTGCGTCGCAAGGTGTTAATGTTTTCCGCATCCCT
TTCGCCTGGCAGTTGATGACACCCACCGTTGGTGGTACTATCGACAGTAACTTCTTCAGACGCTATGATGCCACC
GTTGAAGCTGCCAAGAGCTCTGGTTCCGATCCATATATCATCCTTGACCTACATAATTATGCTCGCTGGAATGGC
CGAATTATTGGCCAGGGAGGTCCAACCAATGAACAATATGCCAGCCTGTGGTCTCAGCTCGCCGCTAAGTACAAG
GAAAATCAGAAAATTATCTTTGGTATCATGAACGAGCCTCACGACGTCCCCAATATCGCTGGCTGGGTCACTTCT
GTACAAACCGTTGTCAACGCCATCCGCGCTGCTGGCGCTACTAATCAATACATCCTCATCCCAGGTTCATCATGG
TCTAGTGCACAAGCACTACCTAATGAAGCCGGACCTCAGCTTCTTACTGTTACCGATCCCTCTGGTGGAACCGAT
AGGCTGATCTTCGACGTCCACAAATACCTGGATTCTGACAACAGTGGGACCCACATTGAATGTACCACGGATAAT
GTTCAAGTCATGCAAACGCTGGTCAATTGGCTACGAGCCAATGGCAATCGGCAAGCAATTCTTAGTGAGACTGGT
GCAGGAAACACCCAATCCTGCTTCACTGCCTTTAAGTCCGAGCTCTCCTTCGTGAAGAGCAACTCGGATTCTATT
ACTGGATTTGCTGCATGGAGTGCCGGCAGCTTTAACACGATGTATGAGTTGACCCTCACTCCCAATCCTGACGGT
TCGGATCAGCCTTTGTGGACTCAGGCGGTTGTTCCCAACCTTCCTTGA
Gene >Agabi119p4|002760
ATGAGATCAATTCTTGTTGCTCTATTCGCCGTCTCGTGTGTTCTTGCCCAACAGCCAGTGAGTCTCATTTGTATA
ACGCAATGCTCTCTGCTGACCACAATTTGAATAGGAATGGGCTCAGTGTGAGTGTATTGTTATCTAAATATCAGA
CGAAATAACAAAGTGTGCTCATCATCTAGGTGGTGGCATTGGTTGGAGTATGTTTACGACTACGCGCGTGTAGCA
AGGCCAAGTTGACATTCATCTACAGCTGGCGGAACGACTTGTGTTTCGGGTTGCGTTTGCACTCCTTTGAATGAC
TGTGAGTACTCATGGCCCTATATCCCAATAATTTTGTTAACATTTCCATCGAGACTACTCACAGTGTCTCCGTGG
GACTGCTACCACAACCACAACCACAAGCTCATCAGGACCGACTCCTACAACTGCACCTAGTCCAGGACGCCTCCC
ATTTTTGGGCGGTATCAATATGGCTGGCTATGACTTCACAGTAGTACGTCGGCAACGTTAATAATCCCTTGTCAA
TCAACACTCAGTTATGTACGTGCCATGCTAGTTTACGGACGGTTCCTTCAATGGCACTGGACAAGATCCTCCCGT
ACAACAATTTTCTCACTTTGCGTCGCAAGGTGTTAATGTTTTCCGCATCCGTAAGTTGATATTAAGTATTGAGTG
CTCCCCCAATCAAACTGAATTACTTCATCCATAGCTTTCGGTGAGCAAAACTTCTGCAACTGTAACAGCCATCTT
TGTTGAATGCAAGTAAAGCCTGGCAGTTGATGACACCCACCGTTGGTGGTACTATCGACAGTAACTTCTTCAGAC
GCTATGATGCCACCGTTGAAGCTGCCAAGAGCTCTGGTTCCGATCCATATATCATCCTTGACCTAGTGAGTGAAC
CTATCCCCTACAATATCTCTTATCCTAATTCCTGCATTCTTAAGCATAATTATGCTCGCTGGAATGGCCGAATTA
TTGGCCAGGGAGGTCCAACCAATGAACAATATGCCAGCCTGTGGTCTCAGCTCGCCGCTAAGTACAAGGAAAATC
AGAAAATTATCGTAGGGAACTATATTTCGGGAATGATATGGCATCTGAACTACTTCCTCAGTTTGGTATCATGAA
CGAGCCTCACGACGTCCCCAATATCGCTGGCTGGGTCACTTCTGTACAAACCGTTGTCAACGCCATCCGCGCTGC
TGGCGCTACTAATCAATACATCCTCATCCCAGGTAGAGATAATCAGTCGCTGTTATAGATCAAGTGTTGACGTGA
TATCTCAAGGTTCATCATGGTCTAGTGCACAAGCACTACCTAATGAAGCCGGACCTCAGCTTCTTACTGTTACCG
ATCCCTCTGGTGGAACCGATAGGCTGATCTTCGACGGTACATCTCTCAGTAAGGCCTCAAAGGAAAAAGATAACC
ATCTTTGTCATCACAGTCCACAAATACCTGGATTCTGACAACAGTGGGACCCACATTGAATGTACCACGGTAAGA
GTGACATTTATATTTGAACGATGAGTGTAACCCGTTCTTTTTTTATATCAAACCTAGGATAATGTTCAAGTCATG
CAAACGCTGGTCAATTGGCTACGAGCCAATGGCAATCGGCAAGCAATTCTTAGTGAGACTGGTGCAGGAAACACC
CAATCCTGCTTCACTGCGTCAGTAACATATTTACTTCTCCTTGACATAGACTGAGACGTTCTATGCAGCTTTAAG
TCCGAGCTCTCCTTCGTGAAGAGCAACTCGGATTCTATTACTGGATTTGCTGCATGGAGTGCCGGCAGCTTTAAC
ACGATGTATGAGTTGACCCTCACTCCCAATCCTGACGGTTCGGATCAGCCTTTGTGGACTCAGGCGGGTGCGTAG
ACCTGATTCATCCAATATACTTTTGACTAATCATATCTTGGCAGTTGTTCCCAACCTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail