Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|002540
Gene name
Locationscaffold_01a:696329..697934
Strand-
Gene length (bp)1605
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11790 Glyco_hydro_cc Glycosyl hydrolase catalytic core 3.3E-65 96 323

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09788|ASL1_SCHPO Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=asl1 PE=1 SV=1 93 324 8.0E-26

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 353 375 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|002540
MSANIMLSVVPFYNSGKNRFGLSIKLEPDCHVTWCHDLDIALGSAFHHSGKGASSSPSSSSASSLSASSSSSSQS
LSFSAPPSAFPTGIKNPKRGLSYASGGNFDDILNANQTKSSISWIYDWSDLPAGFLAQSGLNYIPMQWGSGNIDK
LANTISTQGADIVLGFNEPDFADEANIPAKEAAGLWMQFIEPLKQKDVKLGGPAVTAAPSGKPWISEFLAECNNC
TIDFLPLHWYGSGTEGFFNYIWDMHTTFPQFPIWITEFAEISDNATVVLDFMNQTINYLDSLDWIERYAWFGFFR
PEKDLHSNMLREDGGLNDLGKLYIGAQTVHTSNRTDEPLVTSWPGSNTASPVASLAMLQGSILVGSLLFGVLLAV
A*
Coding >Agabi119p4|002540
ATGTCAGCAAACATTATGCTATCCGTAGTGCCTTTCTATAATTCAGGAAAAAACCGTTTCGGCTTGAGTATTAAA
CTTGAGCCTGATTGCCATGTTACTTGGTGCCACGATTTGGATATCGCTCTCGGCTCTGCTTTTCACCATAGTGGG
AAGGGTGCTTCCTCCTCCCCCTCCTCATCTTCAGCCTCTTCCCTGTCCGCTTCGTCCTCGTCCTCGTCTCAATCT
CTCAGTTTTTCGGCACCTCCATCAGCATTTCCTACTGGTATCAAGAATCCCAAGCGGGGTTTATCGTATGCATCC
GGAGGTAACTTCGACGATATATTGAATGCAAATCAAACCAAAAGCTCCATTTCCTGGATCTACGACTGGTCTGAC
TTACCCGCTGGGTTCCTTGCCCAATCTGGACTAAACTATATTCCCATGCAATGGGGTTCGGGAAATATTGACAAA
CTGGCAAATACAATCAGCACTCAAGGGGCCGACATTGTCCTCGGTTTTAATGAACCGGACTTCGCGGACGAAGCG
AACATTCCGGCGAAAGAAGCTGCCGGACTTTGGATGCAATTCATCGAGCCATTGAAACAGAAAGATGTAAAACTC
GGTGGACCAGCTGTCACTGCTGCACCTAGTGGGAAACCGTGGATAAGTGAGTTTCTGGCGGAGTGCAATAACTGT
ACCATTGACTTTCTGCCGTTGCATTGGTATGGCTCTGGCACCGAGGGGTTTTTCAACTACATCTGGGATATGCAC
ACTACTTTTCCTCAATTCCCCATATGGATAACTGAGTTCGCGGAAATCTCTGACAATGCTACTGTCGTTTTGGAT
TTTATGAATCAGACCATAAATTATCTGGATTCATTAGATTGGATCGAACGTTACGCGTGGTTTGGCTTCTTCCGA
CCGGAGAAAGACCTCCATTCCAATATGTTGCGTGAGGACGGTGGACTGAATGATCTGGGAAAGCTCTACATTGGG
GCTCAAACTGTACATACGTCAAACAGAACAGACGAACCTCTTGTTACGTCGTGGCCCGGGTCGAACACTGCTAGC
CCTGTAGCCTCTCTGGCAATGTTACAAGGCAGCATCCTGGTTGGTTCTCTCCTGTTTGGTGTGCTCTTGGCCGTT
GCTTGA
Transcript >Agabi119p4|002540
ATGTCAGCAAACATTATGCTATCCGTAGTGCCTTTCTATAATTCAGGAAAAAACCGTTTCGGCTTGAGTATTAAA
CTTGAGCCTGATTGCCATGTTACTTGGTGCCACGATTTGGATATCGCTCTCGGCTCTGCTTTTCACCATAGTGGG
AAGGGTGCTTCCTCCTCCCCCTCCTCATCTTCAGCCTCTTCCCTGTCCGCTTCGTCCTCGTCCTCGTCTCAATCT
CTCAGTTTTTCGGCACCTCCATCAGCATTTCCTACTGGTATCAAGAATCCCAAGCGGGGTTTATCGTATGCATCC
GGAGGTAACTTCGACGATATATTGAATGCAAATCAAACCAAAAGCTCCATTTCCTGGATCTACGACTGGTCTGAC
TTACCCGCTGGGTTCCTTGCCCAATCTGGACTAAACTATATTCCCATGCAATGGGGTTCGGGAAATATTGACAAA
CTGGCAAATACAATCAGCACTCAAGGGGCCGACATTGTCCTCGGTTTTAATGAACCGGACTTCGCGGACGAAGCG
AACATTCCGGCGAAAGAAGCTGCCGGACTTTGGATGCAATTCATCGAGCCATTGAAACAGAAAGATGTAAAACTC
GGTGGACCAGCTGTCACTGCTGCACCTAGTGGGAAACCGTGGATAAGTGAGTTTCTGGCGGAGTGCAATAACTGT
ACCATTGACTTTCTGCCGTTGCATTGGTATGGCTCTGGCACCGAGGGGTTTTTCAACTACATCTGGGATATGCAC
ACTACTTTTCCTCAATTCCCCATATGGATAACTGAGTTCGCGGAAATCTCTGACAATGCTACTGTCGTTTTGGAT
TTTATGAATCAGACCATAAATTATCTGGATTCATTAGATTGGATCGAACGTTACGCGTGGTTTGGCTTCTTCCGA
CCGGAGAAAGACCTCCATTCCAATATGTTGCGTGAGGACGGTGGACTGAATGATCTGGGAAAGCTCTACATTGGG
GCTCAAACTGTACATACGTCAAACAGAACAGACGAACCTCTTGTTACGTCGTGGCCCGGGTCGAACACTGCTAGC
CCTGTAGCCTCTCTGGCAATGTTACAAGGCAGCATCCTGGTTGGTTCTCTCCTGTTTGGTGTGCTCTTGGCCGTT
GCTTGA
Gene >Agabi119p4|002540
ATGTCAGCAAACATTATGCTATCCGTAGTGCCTTTCTATAATTCAGGAAAAAACCGTTTCGGCTTGAGTATTAAA
CTTGAGCCTGATTGCGTGGGTTTCCTCCCCTTAGCCTTCCAGACTCTCTGCTATTTGTGCTCACACCCTTTGCTC
CCGCTCCACTAGCATGTTACTTGGTGCCACGATTTGGATATCGCTCTCGGCTCTGCTTGTCACTGTGTCATCTCA
CACACTCAATGTGACATCGACCACGACGTCTGTATCATCAACATCACAAGTTCACCATAGTGGGAAGGGTGCTTC
CTCCTCCCCCTCCTCATCTTCAGCCTCTTCCCTGTCCGCTTCGTCCTCGTCCTCGTCTCAATCTCTCAGTTTTTC
GGCACCTCCATCAGCATTTCCTACTGGTATCAAGAATCCCAAGCGGGGTTTATCGTATGCATCCGGAGGTAACTT
CGACGATATATTGAATGCAAATCAAACCAAAAGCTCCATTTCCTGGATCTACGACTGGTCTGACTTACCCGCTGG
GTTCCTTGCCCAATCTGGACTAAACTATATTCCCATGCAATGGGGTTCGGGAAATATTGACAAACTGGCAAATAC
AATCAGCACTCAAGGGGCCGACATTGTCCTCGTAAGGAATCCAAATCGCCTTGTTCTATATTATTGACGGAAAGT
TAATCGACCATGTGGATTTCAGGGTTTTAATGAACCGGACTTCGCGGACGAAGCGAACATTCCGGCGAAAGAAGC
TGCCGGACTTTGGATGCAATTCATCGAGCCATTGAAACAGAAAGATGTAAAACTCGGTGGACCAGCTGTCACTGC
TGCACCTAGTGGGAAACCGTGGATAAGTGAGTTTCTGGCGGAGTGCAATAACTGTACCATTGACTTTCTGCCGTT
GCATTGGTGAGTCTTCTTCCTATCTGTGACAGCGTGTTTGCCGCTAATGGAGATCGGGAAAAAGGTATGGCTCTG
GCACCGAGGGGTTTTTCAACTACATCTGGGATATGCACACTACTTTTCCTCAATTCCCCATATGGATAACTGAGT
TCGCGGAAATCTCTGACAATGCTACTGGTGAGTGGTTATTTTGCGCCATGCATGGAGATTGACTTATGATATTCC
AGTCGTTTTGGATTTTATGAATCAGACCATAAATTATCTGGATTCATTAGATTGGATCGAACGTTACGCGTGGTT
TGGCTTCTTCGTGAGTGGCTGCCTATCTTGCCGATTAGATTATCATCATACCATCTAATCGGTCTTCTAACAGCG
ACCGGAGAAAGACCTCCATTCCAGTGAGTATATCGCCCTTTACAACCCACACTTACATGCTGACCCTGCATAGAT
ATGTTGCGTGAGGACGGTGGACTGAATGATCTGGGAAAGCTCTACATTGGGGCTCAAACTGTACATACGTCAAAC
AGAACAGACGAAGTTGGTCCCTCATATGCGACTGTCAGCCCGTCTGATCATCCCGGTCAGCCTCTTGTTACGTCG
TGGCCCGGGTCGAACACTGCTAGCCCTGTAGCCTCTCTGGCAATGTTACAAGGCAGCATCCTGGTTGGTTCTCTC
CTGTTTGGTGTGCTCTTGGCCGTTGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail