Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|002530
Gene name
Locationscaffold_01a:694606..695934
Strand-
Gene length (bp)1328
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13202 EF-hand_5 EF hand 2.4E-03 103 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74903|YCS3_SCHPO Uncharacterized calcium-binding protein C613.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.03 PE=3 SV=1 38 197 9.0E-19
sp|P39931|SS120_YEAST Protein SSP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSP120 PE=1 SV=1 38 159 4.0E-06

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|002530
MFTRPLASLSLLALAHYAAAHGGHGESGPKAGETMQQYAQRHMSSEHHIDSFDAPSFFQLHDLNRDGIWDRSEIE
AVYGVHHVYSQKKSKDDEEHQKKADTIVDAVLRILDSNRDGVVDLKELERRGVDALPTFDHMGAEGHHYDVESEF
FLHHEEEFHSTPETQTDDSYNHPEDIEHFGHHEGIEREEAEREAKFAGVSVEEILAAQRAAEEEAAKRTAAQQDI
NNQQNLNAVDPNAPPARSPVIRVTPPEKQDPSVKYAGEKPHGEEWGTGDQGYKSPRDASDKLRKNLPYKYKFRRN
WGDF*
Coding >Agabi119p4|002530
ATGTTCACACGACCGCTGGCCAGCCTTTCTCTTCTCGCTCTTGCACACTATGCAGCCGCTCATGGCGGTCATGGA
GAAAGTGGTCCAAAAGCTGGTGAAACTATGCAGCAATACGCACAAAGACACATGTCTTCAGAACACCATATTGAC
TCCTTCGATGCACCAAGTTTCTTCCAGTTACATGACCTAAATCGGGATGGTATCTGGGACAGATCTGAAATTGAA
GCAGTATATGGCGTTCACCACGTTTATTCACAAAAAAAATCCAAAGATGACGAGGAACACCAAAAGAAAGCGGAT
ACAATTGTTGATGCTGTACTACGGATTCTCGACTCGAACCGCGACGGTGTGGTGGACTTGAAAGAACTGGAAAGG
CGCGGAGTTGACGCTCTACCGACTTTCGACCATATGGGAGCTGAGGGCCACCACTACGATGTGGAAAGTGAATTC
TTTCTTCACCATGAAGAGGAATTCCATTCAACACCCGAAACCCAAACTGACGATTCTTACAACCACCCAGAAGAC
ATCGAACACTTCGGCCATCATGAAGGTATAGAGCGCGAAGAGGCTGAGCGTGAAGCCAAATTTGCTGGCGTGTCC
GTCGAGGAGATTCTTGCCGCACAGAGGGCTGCCGAAGAAGAGGCAGCAAAGCGTACAGCGGCTCAACAAGACATT
AATAACCAACAAAATTTGAATGCAGTCGACCCCAATGCACCTCCTGCACGATCACCCGTAATTCGTGTCACTCCT
CCCGAGAAACAAGATCCCTCTGTTAAATATGCTGGCGAGAAGCCACATGGAGAGGAGTGGGGTACTGGTGACCAA
GGGTACAAGAGCCCTCGCGATGCAAGCGATAAGCTGAGGAAGAACTTGCCTTACAAGTACAAATTCCGTAGGAAT
TGGGGAGATTTCTGA
Transcript >Agabi119p4|002530
ATGTTCACACGACCGCTGGCCAGCCTTTCTCTTCTCGCTCTTGCACACTATGCAGCCGCTCATGGCGGTCATGGA
GAAAGTGGTCCAAAAGCTGGTGAAACTATGCAGCAATACGCACAAAGACACATGTCTTCAGAACACCATATTGAC
TCCTTCGATGCACCAAGTTTCTTCCAGTTACATGACCTAAATCGGGATGGTATCTGGGACAGATCTGAAATTGAA
GCAGTATATGGCGTTCACCACGTTTATTCACAAAAAAAATCCAAAGATGACGAGGAACACCAAAAGAAAGCGGAT
ACAATTGTTGATGCTGTACTACGGATTCTCGACTCGAACCGCGACGGTGTGGTGGACTTGAAAGAACTGGAAAGG
CGCGGAGTTGACGCTCTACCGACTTTCGACCATATGGGAGCTGAGGGCCACCACTACGATGTGGAAAGTGAATTC
TTTCTTCACCATGAAGAGGAATTCCATTCAACACCCGAAACCCAAACTGACGATTCTTACAACCACCCAGAAGAC
ATCGAACACTTCGGCCATCATGAAGGTATAGAGCGCGAAGAGGCTGAGCGTGAAGCCAAATTTGCTGGCGTGTCC
GTCGAGGAGATTCTTGCCGCACAGAGGGCTGCCGAAGAAGAGGCAGCAAAGCGTACAGCGGCTCAACAAGACATT
AATAACCAACAAAATTTGAATGCAGTCGACCCCAATGCACCTCCTGCACGATCACCCGTAATTCGTGTCACTCCT
CCCGAGAAACAAGATCCCTCTGTTAAATATGCTGGCGAGAAGCCACATGGAGAGGAGTGGGGTACTGGTGACCAA
GGGTACAAGAGCCCTCGCGATGCAAGCGATAAGCTGAGGAAGAACTTGCCTTACAAGTACAAATTCCGTAGGAAT
TGGGGAGATTTCTGA
Gene >Agabi119p4|002530
ATGTTCACACGACCGCTGGCCAGCCTTTCTCTTCTCGCTCTTGCACACTATGCAGCCGCTCATGGCGGTCATGGA
GAAAGTGGTCCAAAAGCTGGTGAAACTATGCAGCAATACGCACAAAGACACGTAAGTTGTTAACAATTGAATTTA
AGTTGGTGTGCTGACTTGTCCTTCTAGATGTCTTCAGAACACCATATGTGAGTTTAACGTAGTAATTGTGTGTTG
GTATTGTGTCAATGCGTGGAACGCTGCGAACTAGTGACTCCTTCGATGCACCAAGTTTCTTCCAGTTACATGACC
TAAATCGGTGAGTCGAATTCAAAATCGTCCCAGTATCAGTCACTCATCGCCCAATTCATTAAGGGATGGTATCTG
GGACAGATCTGAAATTGAAGCAGTATATGGCGTTCACCACGTTTATTCACAAAAAAAATCCAAAGTATGTCCAAG
GAAAGTTAATTAGCCAATAGCTTAATACTGTCGACATTGCAGGATGACGAGGAACACCAAAAGAAAGCGGATACA
ATTGTTGATGCTGTACTACGGATTCTCGACTCGAACCGCGACGGTGTGGTGGACTTGAAAGAACTGGAAAGGCGC
GGAGTTGACGCTCTACCGACTTTCGACCATATGGGAGCTGAGGGCCACCACTACGATGTGGAAAGTGGTATGTGG
TAATTGCTTGCTTTCTTGCCTGAACACCGCTAACCAGTATGCAAACAAATACAGAATTCTTTCTTCACCATGAAG
GTACTCTTACCGCGTGACAATTTCCAACAAAAGTTTACTCACACACCTCTTTCCTTCTCAATTACAGAGGAATTC
CATTCAACACCCGAAACCCAAACTGACGATTCTTACAACCACCCAGAAGACATCGAACACTTCGGCCATCATGAA
GGTATAGAGCGCGAAGAGGCTGAGCGTGAAGCCAAATTTGCTGGCGTGTCCGTCGAGGAGATTCTTGCCGCACAG
AGGGCTGCCGAAGAAGAGGCAGCAAAGCGTACAGCGGCTCAACAAGACATTAATAACCAACAAAATTTGAATGCA
GTCGACCCCAATGCACCTCCTGCACGATCACCCGTAATTCGTGTCACTCCTCCCGAGAAACAAGATCCCTCTGTT
AAATATGCTGGCGAGAAGCCACATGGAGAGGAGTGGGGTACTGGTGACCAAGGGTACAAGAGCCCTCGCGATGCA
AGCGATAAGCTGAGGAAGAACTTGCCTTACAAGGTATAATTCTCTACACTATTTTCACCATGTTGCGCTGAGGGC
TGATCCAGTCTCGTATGCAGTACAAATTCCGTAGGAATTGGGGAGATTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail