Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|002160
Gene name
Locationscaffold_01a:559990..562977
Strand-
Gene length (bp)2987
Transcript length (bp)2706
Coding sequence length (bp)2706
Protein length (aa) 902

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18951 DUF5695 Family of unknown function (DUF5695) 0.0E+00 38 891

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|002160
MRFSKPIYLIPFLFGLADAQLGLSDGFTSFKTSTFSMQLVRDSQTLYSLMPSGSEFDFIPRDKMSQREANGRYHL
GDITFRARQVGRSQWVSGDTSTTRRKLTPLSVSGNTLAAANLGPTLPSNSLLDITRRWVDHDGQVQLLFDVKNSQ
NFAVEIGSLGVPLEFNNIFTDRTGADTNEKCSVFDPYIGQDAGFVQVTPLLGTLPPLVVVPVGKSPLEGWRFLPE
SPSGAPFYQSQTFEGLYEWQFHTLAWAQNEWSRVTPWNAPTSFTLQPGQTRTYGIEFRMASSIRNIETALQDAQR
PVAVGLPGYILPMDQVGKLFLHNSAASVQSMSVTPSNALSWTSNSDAKTSGWVGFDITAHTWGRSRLSITYSDGS
LQTVHYYVTHGATRAIADLGNFLTTAQWFDDATDPFKRSPSVISYDREVDAVVKDDPRAWIPGLSDEAGAGSWLA
ATMKQYAQPSQAEVTKLEQFVNTVLWGSIQNSDGTVKKAVFFYEPTLLPNYPYPNDINWRNWWSWDQSASFAIDR
GYDYIHVAAAYWAMYRVARNYPSLVHTHDWQWYISKAVLTVSAMSGRRVGFTNFGLMGETVLTLLLDDLKREGLT
TNATSVEDAMRDRANDWANERFPYGSEMAWDSTGQEGVYAWTRYFNDTKTATNALNSIIAYQPLIPHWGYNGNAR
RYWDNIYGGKLMRYERQIHHYGSGLNSLPLISEFQSSPSDIFLLRLGFGGLTGPLSNIDQDGFASASFHSFPDTL
KWDGYSGDYGPNFSGHAMGMGTFIINHPDFGWQAFGGNIVAKSPAIQVQVKDSIRRRVYLAPLGILLTLDAGAFS
TVAFNPSTKQVDVTITAAPDGASSAAAAPQGRLLVEQKARISGFNGLKPSGNVPVDAGAFVIRFSSGRGQLTLVP
A*
Coding >Agabi119p4|002160
ATGAGGTTCTCAAAGCCCATCTATCTAATCCCCTTTCTCTTTGGGCTTGCCGATGCCCAACTTGGTTTGAGCGAT
GGCTTCACTTCTTTCAAAACATCGACTTTCTCTATGCAGTTGGTCAGAGATTCACAAACGCTCTACTCTCTGATG
CCTTCTGGTTCCGAATTCGATTTTATCCCTCGCGATAAAATGTCTCAACGCGAAGCGAATGGTCGTTATCATTTG
GGGGACATTACCTTTCGGGCTCGGCAAGTTGGACGTTCACAATGGGTATCTGGTGACACGTCGACCACCCGTCGC
AAGCTGACACCATTGTCTGTATCTGGGAATACTCTCGCGGCTGCCAACCTTGGCCCCACTCTCCCATCCAATTCG
CTTCTGGATATCACACGCCGTTGGGTAGATCATGATGGTCAGGTACAGCTCCTCTTCGATGTCAAGAATAGTCAA
AATTTTGCTGTAGAGATTGGTTCACTTGGCGTTCCGTTGGAATTCAATAATATCTTTACTGATCGTACTGGTGCG
GATACGAACGAAAAATGTAGCGTGTTCGATCCGTATATCGGACAAGACGCCGGATTCGTTCAAGTGACGCCTTTA
CTTGGAACTCTTCCGCCTCTAGTGGTCGTTCCCGTTGGTAAATCTCCCTTGGAAGGGTGGAGGTTCCTTCCAGAA
TCGCCGTCTGGTGCGCCTTTCTATCAGTCGCAGACGTTTGAAGGACTGTATGAGTGGCAATTTCATACTCTCGCG
TGGGCACAGAACGAATGGTCGCGTGTCACTCCTTGGAACGCCCCTACGTCTTTCACTCTCCAACCCGGCCAGACG
CGCACATATGGGATTGAATTTCGTATGGCGTCATCTATCAGAAATATCGAAACCGCTCTACAGGATGCCCAGCGT
CCCGTTGCGGTGGGTCTTCCGGGATATATCCTCCCGATGGATCAAGTTGGAAAGCTTTTCCTCCACAACTCTGCA
GCGTCTGTACAGTCTATGAGCGTTACACCATCTAATGCTCTGTCGTGGACCAGTAACTCTGATGCCAAAACGTCA
GGGTGGGTGGGCTTTGATATCACGGCTCATACATGGGGCCGTAGTCGTCTCTCAATTACATACAGCGACGGGTCT
CTTCAGACAGTGCATTACTACGTCACTCATGGGGCAACTCGGGCCATTGCAGACCTTGGAAACTTTTTAACCACC
GCTCAGTGGTTCGATGATGCAACTGATCCCTTTAAACGTTCCCCTTCTGTTATCAGCTATGATCGTGAAGTCGAT
GCCGTTGTGAAGGATGACCCGCGAGCTTGGATACCTGGTCTCAGTGATGAGGCTGGTGCAGGATCCTGGCTGGCG
GCGACGATGAAACAATATGCCCAACCCAGCCAGGCGGAGGTGACTAAACTTGAGCAATTTGTCAATACAGTTCTT
TGGGGTTCTATTCAGAATAGCGATGGAACCGTCAAGAAGGCCGTATTTTTCTATGAACCGACTCTATTGCCCAAT
TACCCTTACCCAAACGACATCAATTGGCGTAATTGGTGGTCTTGGGACCAATCTGCATCATTTGCTATCGATCGT
GGCTATGACTACATCCACGTCGCCGCAGCTTATTGGGCTATGTATCGTGTGGCTCGAAACTATCCTTCCCTCGTC
CATACTCACGACTGGCAATGGTATATCAGCAAAGCCGTCCTCACCGTGTCTGCCATGTCTGGACGAAGAGTTGGG
TTCACGAACTTCGGATTGATGGGCGAAACTGTGCTCACACTGTTATTGGATGACCTAAAGAGAGAAGGTTTAACG
ACAAATGCCACCTCAGTGGAGGACGCGATGAGGGACCGAGCAAACGACTGGGCTAATGAGCGCTTCCCATATGGA
TCGGAAATGGCATGGGACTCAACGGGTCAAGAAGGTGTCTATGCTTGGACCCGTTATTTCAATGATACAAAAACC
GCTACGAACGCCTTAAACTCTATTATTGCATATCAGCCCCTCATTCCACACTGGGGTTATAATGGAAACGCCAGG
CGATACTGGGATAATATCTATGGCGGCAAACTCATGCGTTACGAAAGGCAGATACATCATTATGGAAGTGGGCTC
AATTCTCTTCCTCTGATAAGCGAATTCCAGTCGTCTCCATCGGATATCTTCCTTCTCCGTCTTGGCTTCGGCGGT
CTGACTGGTCCGCTATCCAATATTGATCAAGATGGTTTCGCTTCGGCATCGTTCCACTCTTTTCCCGATACCCTG
AAGTGGGATGGTTACTCTGGAGACTATGGCCCGAACTTTTCGGGTCATGCAATGGGAATGGGGACGTTCATTATC
AATCATCCGGATTTCGGCTGGCAAGCCTTCGGGGGAAATATTGTTGCGAAGTCTCCGGCTATCCAAGTTCAAGTG
AAGGACTCTATTCGACGTCGCGTGTATTTGGCCCCGCTTGGAATCTTACTGACCTTGGACGCTGGTGCCTTCTCG
ACTGTGGCATTCAATCCAAGCACAAAGCAGGTAGATGTGACTATTACAGCTGCTCCTGATGGTGCAAGTTCTGCA
GCTGCGGCTCCTCAGGGTCGTCTTTTGGTGGAGCAGAAGGCTAGGATATCTGGTTTTAATGGTTTGAAGCCCTCT
GGCAATGTTCCCGTCGACGCTGGAGCTTTCGTGATTCGTTTTTCATCTGGGCGAGGACAGCTTACGCTTGTTCCT
GCCTAG
Transcript >Agabi119p4|002160
ATGAGGTTCTCAAAGCCCATCTATCTAATCCCCTTTCTCTTTGGGCTTGCCGATGCCCAACTTGGTTTGAGCGAT
GGCTTCACTTCTTTCAAAACATCGACTTTCTCTATGCAGTTGGTCAGAGATTCACAAACGCTCTACTCTCTGATG
CCTTCTGGTTCCGAATTCGATTTTATCCCTCGCGATAAAATGTCTCAACGCGAAGCGAATGGTCGTTATCATTTG
GGGGACATTACCTTTCGGGCTCGGCAAGTTGGACGTTCACAATGGGTATCTGGTGACACGTCGACCACCCGTCGC
AAGCTGACACCATTGTCTGTATCTGGGAATACTCTCGCGGCTGCCAACCTTGGCCCCACTCTCCCATCCAATTCG
CTTCTGGATATCACACGCCGTTGGGTAGATCATGATGGTCAGGTACAGCTCCTCTTCGATGTCAAGAATAGTCAA
AATTTTGCTGTAGAGATTGGTTCACTTGGCGTTCCGTTGGAATTCAATAATATCTTTACTGATCGTACTGGTGCG
GATACGAACGAAAAATGTAGCGTGTTCGATCCGTATATCGGACAAGACGCCGGATTCGTTCAAGTGACGCCTTTA
CTTGGAACTCTTCCGCCTCTAGTGGTCGTTCCCGTTGGTAAATCTCCCTTGGAAGGGTGGAGGTTCCTTCCAGAA
TCGCCGTCTGGTGCGCCTTTCTATCAGTCGCAGACGTTTGAAGGACTGTATGAGTGGCAATTTCATACTCTCGCG
TGGGCACAGAACGAATGGTCGCGTGTCACTCCTTGGAACGCCCCTACGTCTTTCACTCTCCAACCCGGCCAGACG
CGCACATATGGGATTGAATTTCGTATGGCGTCATCTATCAGAAATATCGAAACCGCTCTACAGGATGCCCAGCGT
CCCGTTGCGGTGGGTCTTCCGGGATATATCCTCCCGATGGATCAAGTTGGAAAGCTTTTCCTCCACAACTCTGCA
GCGTCTGTACAGTCTATGAGCGTTACACCATCTAATGCTCTGTCGTGGACCAGTAACTCTGATGCCAAAACGTCA
GGGTGGGTGGGCTTTGATATCACGGCTCATACATGGGGCCGTAGTCGTCTCTCAATTACATACAGCGACGGGTCT
CTTCAGACAGTGCATTACTACGTCACTCATGGGGCAACTCGGGCCATTGCAGACCTTGGAAACTTTTTAACCACC
GCTCAGTGGTTCGATGATGCAACTGATCCCTTTAAACGTTCCCCTTCTGTTATCAGCTATGATCGTGAAGTCGAT
GCCGTTGTGAAGGATGACCCGCGAGCTTGGATACCTGGTCTCAGTGATGAGGCTGGTGCAGGATCCTGGCTGGCG
GCGACGATGAAACAATATGCCCAACCCAGCCAGGCGGAGGTGACTAAACTTGAGCAATTTGTCAATACAGTTCTT
TGGGGTTCTATTCAGAATAGCGATGGAACCGTCAAGAAGGCCGTATTTTTCTATGAACCGACTCTATTGCCCAAT
TACCCTTACCCAAACGACATCAATTGGCGTAATTGGTGGTCTTGGGACCAATCTGCATCATTTGCTATCGATCGT
GGCTATGACTACATCCACGTCGCCGCAGCTTATTGGGCTATGTATCGTGTGGCTCGAAACTATCCTTCCCTCGTC
CATACTCACGACTGGCAATGGTATATCAGCAAAGCCGTCCTCACCGTGTCTGCCATGTCTGGACGAAGAGTTGGG
TTCACGAACTTCGGATTGATGGGCGAAACTGTGCTCACACTGTTATTGGATGACCTAAAGAGAGAAGGTTTAACG
ACAAATGCCACCTCAGTGGAGGACGCGATGAGGGACCGAGCAAACGACTGGGCTAATGAGCGCTTCCCATATGGA
TCGGAAATGGCATGGGACTCAACGGGTCAAGAAGGTGTCTATGCTTGGACCCGTTATTTCAATGATACAAAAACC
GCTACGAACGCCTTAAACTCTATTATTGCATATCAGCCCCTCATTCCACACTGGGGTTATAATGGAAACGCCAGG
CGATACTGGGATAATATCTATGGCGGCAAACTCATGCGTTACGAAAGGCAGATACATCATTATGGAAGTGGGCTC
AATTCTCTTCCTCTGATAAGCGAATTCCAGTCGTCTCCATCGGATATCTTCCTTCTCCGTCTTGGCTTCGGCGGT
CTGACTGGTCCGCTATCCAATATTGATCAAGATGGTTTCGCTTCGGCATCGTTCCACTCTTTTCCCGATACCCTG
AAGTGGGATGGTTACTCTGGAGACTATGGCCCGAACTTTTCGGGTCATGCAATGGGAATGGGGACGTTCATTATC
AATCATCCGGATTTCGGCTGGCAAGCCTTCGGGGGAAATATTGTTGCGAAGTCTCCGGCTATCCAAGTTCAAGTG
AAGGACTCTATTCGACGTCGCGTGTATTTGGCCCCGCTTGGAATCTTACTGACCTTGGACGCTGGTGCCTTCTCG
ACTGTGGCATTCAATCCAAGCACAAAGCAGGTAGATGTGACTATTACAGCTGCTCCTGATGGTGCAAGTTCTGCA
GCTGCGGCTCCTCAGGGTCGTCTTTTGGTGGAGCAGAAGGCTAGGATATCTGGTTTTAATGGTTTGAAGCCCTCT
GGCAATGTTCCCGTCGACGCTGGAGCTTTCGTGATTCGTTTTTCATCTGGGCGAGGACAGCTTACGCTTGTTCCT
GCCTAG
Gene >Agabi119p4|002160
ATGAGGTTCTCAAAGCCCATCTATCTAATCCCCTTTCTCTTTGGGCTTGCCGATGCCCAACTTGGTTTGAGCGAT
GGCTTCACTTCTTTCAAAACATCGACTTTCTCTATGCAGTTGGTCAGAGATTCACAAACGCTCTACTCTCTGATG
CCTTCTGGTTCCGAATTCGATTTTATCCCTCGCGATAAAATGTCTCAACGCGAAGCGAATGGTCGTTATCATTTG
GGGGACATTACCTTTCGGGCTCGGCAAGTTGGACGTTCACAATGGGTATCTGGTGACACGTCGACCACCCGTCGC
AAGCTGACACCATTGTCTGTATCTGGGAATACTCTCGCGGCTGCCAACCTTGGCCCCACTCTCCCATCCAATTCG
CTTCTGGATATCACACGCCGTTGGGTAGATCATGATGGTCAGGTACAGCTCCTCTTCGATGTCAAGAATAGTCAA
AATTTTGCTGTAGAGATTGGTTCACTTGGCGTTCCGTTGGAATTCAATAATGTAAGTGTAGACCTATCAGACCTT
TTGAACGTTATTGATTCTCCCGGTTAGATCTTTACTGATCGTACTGGTGCGGATACGAACGAAAAATGTAGCGTG
TTCGATCCGTATATCGGACAAGACGCCGGATTCGTTCAAGTGACGCCTTTACTTGGAACTCTTCCGCCTCTAGTG
GTCGTTCCCGTTGGTAAATCTCCCTTGGAAGGGTGGAGGTTCCTTCCAGAATCGCCGTCTGGTGCGCCTTTCTAT
CAGTCGCAGACGTTTGAAGGACTGTATGAGTGGCAATTTCATACTCTCGCGTGGGCACAGAACGAATGGTCGCGT
GTCACTCCTTGGAACGCCCCTACGTCTTTCACTCTCCAACCCGGCCAGACGCGCACATATGGGATTGAATTTCGT
ATGGCGTCATCTATCAGAAATATCGAAACCGCTCTACAGGATGCCCAGCGTCCCGTTGCGGTGGGTCTTCCGGGA
TATATCCTCCCGATGGATCAAGTTGGAAAGCTTTTCCTCCACAACTCTGCAGCGTCTGTACAGTCTATGAGCGTT
ACACCATCTAATGCTCTGTCGTGGACCAGTAACTCTGATGCCAAAACGTCAGGGTGGGTGGGCTTTGATATCACG
GCTCATACATGGGGCCGTAGTCGTCTCTCAATTACATACAGCGACGGGTCTCTTCAGACAGTGCATTACTACGTC
ACTCATGGGGCAACTCGGGCCATTGCAGACCTTGGAAACTTTTTAACCACCGCTCAGTGGTTCGATGATGCAACT
GATCCCTTTAAACGTTCCCCTTCTGTTATCAGCTATGATCGTGAAGTCGATGCCGTTGTGAAGGATGACCCGCGA
GCTTGGATACCTGGTCTCAGTGATGAGGCTGGTGCAGGATCCTGGCTGGCGGCGACGATGAAACAATATGCCCAA
CCCAGCCAGGCGGAGGTGACTAAACTTGAGCAATTTGTCAATACAGTTCTTTGGGGTTCTATTCAGAATAGCGAT
GGTACGTTTCTCGTTCCAGTTTGTACATTCATCATCTGTCCTAAACTCACTATATGGTGTTGCAGGAACCGTCAA
GAAGGTGATTTCATTTGTTAACCTAAATTCCTAGTTTTGAAGTAATGACATCCGACGCAGGCCGTATTTTTCTAT
GAACCGACTCTATTGCCCAATTACCCTTACCCAAACGACATCAATTGGCGTAATTGGTGGTCTTGGGACCAATCT
GCATCATTTGCTATCGATCGTGGCTATGACTACATCCACGTCGCCGCAGCTTATTGGGCTATGTATCGTGTGGCT
CGAAACTATCCTTCCCTCGTCCATACTCACGACTGGCAATGGTATATCAGCAAAGCCGTCCTCACCGTGTCTGCC
ATGTCTGGACGAAGAGTTGGGTTCACGAACTTCGGATTGATGGGCGAAACTGTGCTCACACTGTTATTGGATGAC
CTAAAGAGAGAAGGTTTAACGACAAATGCCACCTCAGTGGAGGACGCGATGAGGGACCGAGCAAACGACTGGGCT
AATGAGCGCTTCCCGTGAGTTGGCACATTCACATTGAAGGACATCTACAGACCCCCAGTTTCTTCTAGATATGGA
TCGGAAATGGCATGGGACTCAACGGGTCAAGAAGGTGTCTATGCTTGGACCCGTTATTTCAATGATACAAAAACC
GCTACGAACGCCTTAAACTCTATTATTGCATATCAGCCCCTCATTCCACACTGGGGTTATAATGGAAACGCCAGG
CGATACTGGTTCGTCATAAATGCGATAGGAATGCATGTCCATGACTTCTGACCCTTTCCAATAGGGATAATATCT
ATGGCGGCAAACTCATGCGTTACGAAAGGCAGATACATCATTATGGAAGTGGGCTCAATTCTCTTCCTCTGATAA
GCGAATTCCAGTCGTCTCCATCGGATATCTTCCTTCTCCGTCTTGGCTTCGGCGGTCTGACTGGTCCGCTATCCA
ATATTGATCAAGATGGTTTCGCTTCGGCATCGTTCCACTCTTTTCCCGATACCCTGAAGTGGGATGGTTACTCTG
GAGACTATGGCCCGAACTTTTCGGGTCATGCAATGGGAATGGGGACGTTCATTATCAATCATCCGGATTTCGGCT
GGCAAGCCTTCGGGGGAAATATTGTTGCGAAGTCTCCGGCTATCCAAGTTCAAGTGAAGGACTCTATTCGACGTC
GCGTGTATTTGGCCCCGCTTGGAATCTTACTGACCTTGGACGCTGGTGCCTTCTCGACTGTGGCATTCAATCCAA
GCACAAAGCAGGTAGATGTGACTATTACAGCTGCTCCTGATGGTGCAAGTTCTGCAGCTGCGGCTCCTCAGGGTC
GTCTTTTGGTGGAGCAGAAGGCTAGGATATCTGGTTTTAATGGTTTGAAGCCCTCTGGCAATGTTCCCGTCGACG
CTGGAGCTTTCGTGATTCGTTTTTCATCTGGGCGAGGACAGCTTACGCTTGTTCCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail