Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|002130
Gene name
Locationscaffold_01a:553976..555037
Strand-
Gene length (bp)1061
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00227 Proteasome Proteasome subunit 3.7E-57 31 219
PF10584 Proteasome_A_N Proteasome subunit A N-terminal signature 1.2E-13 8 30

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT97|PSA5_SCHPO Probable proteasome subunit alpha type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup2 PE=1 SV=1 1 241 6.0E-126
sp|P32379|PSA5_YEAST Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2 1 242 3.0E-121
sp|Q9LSU1|PSA5_ORYSJ Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 1 242 2.0E-114
sp|Q9Z2U1|PSA5_MOUSE Proteasome subunit alpha type-5 OS=Mus musculus GN=Psma5 PE=1 SV=1 1 242 6.0E-113
sp|P28066|PSA5_HUMAN Proteasome subunit alpha type-5 OS=Homo sapiens GN=PSMA5 PE=1 SV=3 1 242 6.0E-113
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT97|PSA5_SCHPO Probable proteasome subunit alpha type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup2 PE=1 SV=1 1 241 6.0E-126
sp|P32379|PSA5_YEAST Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2 1 242 3.0E-121
sp|Q9LSU1|PSA5_ORYSJ Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 1 242 2.0E-114
sp|Q9Z2U1|PSA5_MOUSE Proteasome subunit alpha type-5 OS=Mus musculus GN=Psma5 PE=1 SV=1 1 242 6.0E-113
sp|P28066|PSA5_HUMAN Proteasome subunit alpha type-5 OS=Homo sapiens GN=PSMA5 PE=1 SV=3 1 242 6.0E-113
sp|Q5E987|PSA5_BOVIN Proteasome subunit alpha type-5 OS=Bos taurus GN=PSMA5 PE=1 SV=1 1 242 6.0E-113
sp|Q42134|PSA5B_ARATH Proteasome subunit alpha type-5-B OS=Arabidopsis thaliana GN=PAE2 PE=1 SV=2 1 242 5.0E-111
sp|Q9M4T8|PSA5_SOYBN Proteasome subunit alpha type-5 OS=Glycine max GN=PAE1 PE=2 SV=1 1 242 9.0E-111
sp|O81149|PSA5A_ARATH Proteasome subunit alpha type-5-A OS=Arabidopsis thaliana GN=PAE1 PE=1 SV=1 1 242 1.0E-110
sp|P34064|PSA5_RAT Proteasome subunit alpha type-5 OS=Rattus norvegicus GN=Psma5 PE=1 SV=1 1 242 5.0E-110
sp|Q55G04|PSA5_DICDI Proteasome subunit alpha type-5 OS=Dictyostelium discoideum GN=psmA5 PE=3 SV=1 1 242 1.0E-108
sp|Q94561|PSA5_ENTHI Proteasome subunit alpha type-5 OS=Entamoeba histolytica PE=3 SV=2 1 242 6.0E-108
sp|Q9XZG5|PSA5_TRYBB Proteasome subunit alpha type-5 OS=Trypanosoma brucei brucei PE=3 SV=1 1 240 9.0E-104
sp|Q95083|PSA5_DROME Proteasome subunit alpha type-5 OS=Drosophila melanogaster GN=Prosalpha5 PE=2 SV=2 1 227 7.0E-103
sp|Q95008|PSA5_CAEEL Proteasome subunit alpha type-5 OS=Caenorhabditis elegans GN=pas-5 PE=1 SV=1 1 218 2.0E-90
sp|Q8TYB7|PSA_METKA Proteasome subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmA PE=3 SV=1 5 242 3.0E-65
sp|Q6M0L9|PSA_METMP Proteasome subunit alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=psmA PE=3 SV=1 6 226 1.0E-64
sp|A4FZT6|PSA_METM5 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmA PE=3 SV=1 6 226 1.0E-64
sp|A6VIP0|PSA_METM7 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmA PE=3 SV=1 6 226 1.0E-64
sp|A6URN9|PSA_METVS Proteasome subunit alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmA PE=3 SV=1 6 226 2.0E-64
sp|A9A846|PSA_METM6 Proteasome subunit alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmA PE=3 SV=1 6 226 1.0E-63
sp|Q469M6|PSA_METBF Proteasome subunit alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmA PE=3 SV=1 8 230 1.0E-62
sp|Q8PTU1|PSA_METMA Proteasome subunit alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmA PE=3 SV=1 8 230 2.0E-62
sp|Q8TPX5|PSA_METAC Proteasome subunit alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmA PE=3 SV=1 8 242 2.0E-62
sp|Q59565|PSA_METTE Proteasome subunit alpha OS=Methanosarcina thermophila GN=psmA PE=3 SV=1 8 231 3.0E-62
sp|B8GEZ3|PSA_METPE Proteasome subunit alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmA PE=3 SV=1 8 242 4.0E-62
sp|A5UJS2|PSA_METS3 Proteasome subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmA PE=3 SV=1 3 221 1.0E-61
sp|O26782|PSA_METTH Proteasome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmA PE=3 SV=1 3 242 4.0E-61
sp|C6A459|PSA_THESM Proteasome subunit alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmA PE=3 SV=1 8 241 9.0E-61
sp|A7I9C7|PSA_METB6 Proteasome subunit alpha OS=Methanoregula boonei (strain 6A8) GN=psmA PE=3 SV=1 8 221 2.0E-60
sp|Q9V122|PSA_PYRAB Proteasome subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmA PE=3 SV=1 8 236 5.0E-60
sp|O29760|PSA_ARCFU Proteasome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmA PE=1 SV=1 1 240 2.0E-59
sp|O59219|PSA_PYRHO Proteasome subunit alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmA PE=3 SV=1 8 230 2.0E-58
sp|Q5V1D4|PSA2_HALMA Proteasome subunit alpha 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA2 PE=3 SV=1 8 232 5.0E-58
sp|Q60177|PSA_METJA Proteasome subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmA PE=1 SV=1 6 228 5.0E-58
sp|Q3IPJ1|PSA_NATPD Proteasome subunit alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmA PE=3 SV=1 8 241 6.0E-58
sp|Q8U0L6|PSA_PYRFU Proteasome subunit alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmA PE=3 SV=1 8 230 2.0E-57
sp|Q8ZVM1|PSA_PYRAE Proteasome subunit alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmA PE=3 SV=1 8 222 6.0E-57
sp|P57697|PSA_HALSA Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmA PE=3 SV=1 8 226 1.0E-56
sp|B0R2T2|PSA_HALS3 Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmA PE=3 SV=1 8 226 1.0E-56
sp|Q18K08|PSA_HALWD Proteasome subunit alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmA PE=3 SV=1 8 224 2.0E-56
sp|A3CW55|PSA_METMJ Proteasome subunit alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmA PE=3 SV=1 8 242 2.0E-56
sp|P25156|PSA_THEAC Proteasome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmA PE=1 SV=2 8 232 4.0E-56
sp|B6YSH9|PSA_THEON Proteasome subunit alpha OS=Thermococcus onnurineus (strain NA1) GN=psmA PE=3 SV=1 8 232 3.0E-55
sp|Q97BZ8|PSA_THEVO Proteasome subunit alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmA PE=3 SV=2 8 229 5.0E-55
sp|Q5JIU9|PSA_THEKO Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 8 242 8.0E-55
sp|O24733|PSA_THEK1 Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 8 242 2.0E-54
sp|C3NEC6|PSA_SULIY Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmA PE=3 SV=1 8 227 6.0E-54
sp|C3NHC6|PSA_SULIN Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmA PE=3 SV=1 8 227 6.0E-54
sp|C3MVG1|PSA_SULIM Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmA PE=3 SV=1 8 227 6.0E-54
sp|C3MQ43|PSA_SULIL Proteasome subunit alpha OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmA PE=3 SV=1 8 227 6.0E-54
sp|C4KHD9|PSA_SULIK Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmA PE=3 SV=1 8 227 6.0E-54
sp|C3N5R0|PSA_SULIA Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.27) GN=psmA PE=3 SV=1 8 227 6.0E-54
sp|Q5V2X8|PSA1_HALMA Proteasome subunit alpha 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA1 PE=3 SV=1 8 221 1.0E-53
sp|C5A2C2|PSA_THEGJ Proteasome subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmA PE=3 SV=1 8 232 2.0E-53
sp|Q9UXC6|PSA_SULSO Proteasome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmA PE=3 SV=1 8 227 4.0E-53
sp|Q9V2V6|PSA1_HALVD Proteasome subunit alpha 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA1 PE=1 SV=2 8 222 1.0E-52
sp|A4YCU9|PSA_METS5 Proteasome subunit alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmA PE=3 SV=1 8 227 4.0E-52
sp|Q4JB24|PSA_SULAC Proteasome subunit alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmA PE=3 SV=1 8 226 2.0E-51
sp|Q9SXU1|PSA7_CICAR Proteasome subunit alpha type-7 OS=Cicer arietinum GN=PAD1 PE=2 SV=1 6 239 3.0E-51
sp|P0C1G8|PSA4A_ORYSJ Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. japonica GN=PAC1 PE=2 SV=1 8 226 3.0E-51
sp|A2Y9X7|PSA4A_ORYSI Proteasome subunit alpha type-4-1 OS=Oryza sativa subsp. indica GN=OsI_021120 PE=1 SV=2 8 226 3.0E-51
sp|O24030|PSA7_SOLLC Proteasome subunit alpha type-7 OS=Solanum lycopersicum GN=PAD1 PE=2 SV=1 6 239 4.0E-51
sp|Q5VRG3|PSA4B_ORYSJ Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. japonica GN=Os06g0167600 PE=2 SV=1 8 226 1.0E-50
sp|P0C8Y9|PSA4B_ORYSI Proteasome subunit alpha type-4-2 OS=Oryza sativa subsp. indica GN=OsI_021067 PE=1 SV=1 8 226 1.0E-50
sp|Q975G5|PSA_SULTO Proteasome subunit alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmA PE=3 SV=2 8 226 2.0E-50
sp|O82530|PSA4_PETHY Proteasome subunit alpha type-4 OS=Petunia hybrida GN=PAC1 PE=2 SV=1 8 226 3.0E-50
sp|O81148|PSA4A_ARATH Proteasome subunit alpha type-4-A OS=Arabidopsis thaliana GN=PAC1 PE=1 SV=1 8 221 1.0E-49
sp|Q0J006|PSA7B_ORYSJ Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. japonica GN=PAD1 PE=2 SV=1 6 235 5.0E-49
sp|A2Z3I9|PSA7B_ORYSI Proteasome subunit alpha type-7-B OS=Oryza sativa subsp. indica GN=PAD1 PE=2 SV=1 6 235 5.0E-49
sp|P52427|PSA4_SPIOL Proteasome subunit alpha type-4 OS=Spinacia oleracea GN=PAC1 PE=2 SV=1 8 221 5.0E-49
sp|Q9YC01|PSA_AERPE Proteasome subunit alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmA PE=3 SV=1 5 242 2.0E-48
sp|Q9U793|PSA2_TRYBB Proteasome subunit alpha type-2 OS=Trypanosoma brucei brucei PE=2 SV=1 6 242 2.0E-48
sp|O24616|PSA7B_ARATH Proteasome subunit alpha type-7-B OS=Arabidopsis thaliana GN=PAD2 PE=1 SV=2 6 239 4.0E-48
sp|P34119|PSA4_DICDI Proteasome subunit alpha type-4 OS=Dictyostelium discoideum GN=psmA4 PE=2 SV=1 8 241 5.0E-48
sp|O13268|PSA7_CHICK Proteasome subunit alpha type-7 OS=Gallus gallus GN=PSMA7 PE=2 SV=1 8 230 7.0E-48
sp|Q6YT00|PSA7A_ORYSJ Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. japonica GN=Os08g0548900 PE=2 SV=1 6 235 8.0E-48
sp|A2YXU2|PSA7A_ORYSI Proteasome subunit alpha type-7-A OS=Oryza sativa subsp. indica GN=OsI_029135 PE=2 SV=2 6 235 8.0E-48
sp|Q6L0W3|PSA_PICTO Proteasome subunit alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmA PE=3 SV=1 8 230 1.0E-47
sp|Q5RDH8|PSA7_PONAB Proteasome subunit alpha type-7 OS=Pongo abelii GN=PSMA7 PE=2 SV=2 8 231 2.0E-47
sp|Q9V2V5|PSA2_HALVD Proteasome subunit alpha 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA2 PE=1 SV=1 8 232 2.0E-47
sp|O14818|PSA7_HUMAN Proteasome subunit alpha type-7 OS=Homo sapiens GN=PSMA7 PE=1 SV=1 8 231 3.0E-47
sp|Q9PTW9|PSA7_CARAU Proteasome subunit alpha type-7 OS=Carassius auratus GN=psma7 PE=2 SV=1 6 239 3.0E-47
sp|Q3ZBG0|PSA7_BOVIN Proteasome subunit alpha type-7 OS=Bos taurus GN=PSMA7 PE=1 SV=1 8 239 3.0E-47
sp|Q9CWH6|PSA7L_MOUSE Proteasome subunit alpha type-7-like OS=Mus musculus GN=Psma8 PE=1 SV=1 6 242 6.0E-47
sp|Q9Z2U0|PSA7_MOUSE Proteasome subunit alpha type-7 OS=Mus musculus GN=Psma7 PE=1 SV=1 8 239 6.0E-47
sp|P30186|PSA7A_ARATH Proteasome subunit alpha type-7-A OS=Arabidopsis thaliana GN=PAD1 PE=1 SV=1 6 226 3.0E-46
sp|Q95005|PSA7_CAEEL Proteasome subunit alpha type-7 OS=Caenorhabditis elegans GN=pas-4 PE=1 SV=1 6 223 4.0E-46
sp|Q4R7D9|PSA7L_MACFA Proteasome subunit alpha type-7-like OS=Macaca fascicularis GN=PSMA7L PE=2 SV=1 6 230 1.0E-45
sp|Q9PVQ1|PSA7B_XENLA Proteasome subunit alpha type-7-B OS=Xenopus laevis GN=psma7-b PE=2 SV=1 8 231 1.0E-45
sp|Q9PVY6|PSA7A_XENLA Proteasome subunit alpha type-7-A OS=Xenopus laevis GN=psma7-a PE=2 SV=1 8 231 1.0E-45
sp|Q09682|PSA3_SCHPO Probable proteasome subunit alpha type-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.01c PE=3 SV=1 3 224 2.0E-45
sp|P34120|PSA7_DICDI Proteasome subunit alpha type-7 OS=Dictyostelium discoideum GN=psmA7 PE=3 SV=1 3 240 3.0E-45
sp|Q10329|PSA4_SCHPO Probable proteasome subunit alpha type-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre6 PE=3 SV=1 6 242 5.0E-45
sp|Q9N599|PSA4_CAEEL Proteasome subunit alpha type-4 OS=Caenorhabditis elegans GN=pas-3 PE=3 SV=2 8 232 6.0E-45
sp|Q27563|PSA3_DICDI Proteasome subunit alpha type-3 OS=Dictyostelium discoideum GN=psmA3 PE=2 SV=2 6 229 6.0E-45
sp|Q10KF0|PSA2_ORYSJ Proteasome subunit alpha type-2 OS=Oryza sativa subsp. japonica GN=PAB1 PE=2 SV=1 6 242 1.0E-44
sp|A2YVR7|PSA2_ORYSI Proteasome subunit alpha type-2 OS=Oryza sativa subsp. indica GN=PAB1 PE=2 SV=2 6 242 1.0E-44
sp|P25789|PSA4_HUMAN Proteasome subunit alpha type-4 OS=Homo sapiens GN=PSMA4 PE=1 SV=1 8 226 2.0E-44
sp|Q3ZCK9|PSA4_BOVIN Proteasome subunit alpha type-4 OS=Bos taurus GN=PSMA4 PE=1 SV=1 8 226 2.0E-44
sp|P21670|PSA4_RAT Proteasome subunit alpha type-4 OS=Rattus norvegicus GN=Psma4 PE=1 SV=1 8 226 3.0E-44
sp|Q9R1P0|PSA4_MOUSE Proteasome subunit alpha type-4 OS=Mus musculus GN=Psma4 PE=1 SV=1 8 226 3.0E-44
sp|P48004|PSA7_RAT Proteasome subunit alpha type-7 OS=Rattus norvegicus GN=Psma7 PE=1 SV=1 8 230 5.0E-44
sp|Q4R932|PSA4_MACFA Proteasome subunit alpha type-4 OS=Macaca fascicularis GN=PSMA4 PE=2 SV=1 8 226 6.0E-44
sp|Q8SRU3|PSA5_ENCCU Probable proteasome subunit alpha type-5 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP2 PE=1 SV=1 7 215 8.0E-44
sp|P22769|PSA71_DROME Proteasome subunit alpha type-7-1 OS=Drosophila melanogaster GN=Prosalpha4 PE=1 SV=2 6 231 2.0E-43
sp|O94579|PSA2_SCHPO Probable proteasome subunit alpha type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre8 PE=3 SV=1 7 222 1.0E-42
sp|Q8L4A7|PSA2B_ARATH Proteasome subunit alpha type-2-B OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 6 242 1.0E-42
sp|O23708|PSA2A_ARATH Proteasome subunit alpha type-2-A OS=Arabidopsis thaliana GN=PAB1 PE=1 SV=1 6 242 2.0E-42
sp|O23712|PSA1B_ARATH Proteasome subunit alpha type-1-B OS=Arabidopsis thaliana GN=PAF2 PE=1 SV=2 3 240 2.0E-42
sp|P34066|PSA1A_ARATH Proteasome subunit alpha type-1-A OS=Arabidopsis thaliana GN=PAF1 PE=1 SV=3 3 240 3.0E-42
sp|Q27562|PSA1_DICDI Proteasome subunit alpha type-1 OS=Dictyostelium discoideum GN=psmA1 PE=3 SV=1 3 239 3.0E-42
sp|P23638|PSA3_YEAST Proteasome subunit alpha type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE9 PE=1 SV=1 8 223 3.0E-42
sp|Q54DM7|PSA2_DICDI Proteasome subunit alpha type-2 OS=Dictyostelium discoideum GN=psmA2 PE=3 SV=1 6 236 5.0E-42
sp|O24362|PSA3_SPIOL Proteasome subunit alpha type-3 OS=Spinacia oleracea GN=PAG1 PE=2 SV=1 8 234 7.0E-42
sp|Q8TAA3|PSA7L_HUMAN Proteasome subunit alpha type-7-like OS=Homo sapiens GN=PSMA8 PE=2 SV=3 6 230 1.0E-41
sp|P52428|PSA1_ORYSJ Proteasome subunit alpha type-1 OS=Oryza sativa subsp. japonica GN=PAF1 PE=2 SV=1 3 242 1.0E-41
sp|P40301|PSA2_DROME Proteasome subunit alpha type-2 OS=Drosophila melanogaster GN=Prosalpha2 PE=1 SV=1 8 236 2.0E-41
sp|O16811|PSA71_DROVI Proteasome subunit alpha type-7-1 OS=Drosophila virilis GN=Pros28.1 PE=3 SV=1 6 231 2.0E-41
sp|Q24178|PSA72_DROME Proteasome subunit alpha type-7-1A OS=Drosophila melanogaster GN=Prosalpha4T1 PE=2 SV=2 6 240 3.0E-41
sp|P18053|PSA4_DROME Proteasome subunit alpha type-4 OS=Drosophila melanogaster GN=Prosalpha3 PE=1 SV=2 8 241 2.0E-40
sp|P40303|PSA4_YEAST Proteasome subunit alpha type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE6 PE=1 SV=1 6 224 6.0E-40
sp|Q9LSU0|PSA3_ORYSJ Proteasome subunit alpha type-3 OS=Oryza sativa subsp. japonica GN=PAG1 PE=2 SV=1 8 242 1.0E-39
sp|Q8X077|PSA2_NEUCR Probable proteasome subunit alpha type-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pca-2 PE=3 SV=1 8 221 3.0E-39
sp|O23715|PSA3_ARATH Proteasome subunit alpha type-3 OS=Arabidopsis thaliana GN=PAG1 PE=1 SV=2 8 229 3.0E-39
sp|Q27575|PSA73_DROME Proteasome subunit alpha type-7-1B OS=Drosophila melanogaster GN=Prosalpha4T2 PE=2 SV=2 8 194 4.0E-39
sp|Q4R3H2|PSA1_MACFA Proteasome subunit alpha type-1 OS=Macaca fascicularis GN=PSMA1 PE=2 SV=1 3 240 4.0E-39
sp|Q3T0X5|PSA1_BOVIN Proteasome subunit alpha type-1 OS=Bos taurus GN=PSMA1 PE=1 SV=1 3 240 5.0E-39
sp|P25786|PSA1_HUMAN Proteasome subunit alpha type-1 OS=Homo sapiens GN=PSMA1 PE=1 SV=1 3 240 5.0E-39
sp|P18420|PSA1_RAT Proteasome subunit alpha type-1 OS=Rattus norvegicus GN=Psma1 PE=1 SV=2 3 232 7.0E-39
sp|Q5REN2|PSA1_PONAB Proteasome subunit alpha type-1 OS=Pongo abelii GN=PSMA1 PE=2 SV=1 3 240 1.0E-38
sp|Q9R1P4|PSA1_MOUSE Proteasome subunit alpha type-1 OS=Mus musculus GN=Psma1 PE=1 SV=1 3 232 1.0E-38
sp|P12881|PSA1_DROME Proteasome subunit alpha type-1 OS=Drosophila melanogaster GN=Prosalpha6 PE=1 SV=1 1 241 2.0E-38
sp|P17220|PSA2_RAT Proteasome subunit alpha type-2 OS=Rattus norvegicus GN=Psma2 PE=1 SV=3 8 230 2.0E-38
sp|P49722|PSA2_MOUSE Proteasome subunit alpha type-2 OS=Mus musculus GN=Psma2 PE=1 SV=3 8 230 2.0E-38
sp|P25787|PSA2_HUMAN Proteasome subunit alpha type-2 OS=Homo sapiens GN=PSMA2 PE=1 SV=2 8 230 2.0E-38
sp|Q3T0Y5|PSA2_BOVIN Proteasome subunit alpha type-2 OS=Bos taurus GN=PSMA2 PE=1 SV=3 8 230 2.0E-38
sp|P60901|PSA6_RAT Proteasome subunit alpha type-6 OS=Rattus norvegicus GN=Psma6 PE=1 SV=1 8 237 2.0E-37
sp|P60900|PSA6_HUMAN Proteasome subunit alpha type-6 OS=Homo sapiens GN=PSMA6 PE=1 SV=1 8 237 2.0E-37
sp|Q2YDE4|PSA6_BOVIN Proteasome subunit alpha type-6 OS=Bos taurus GN=PSMA6 PE=1 SV=1 8 237 2.0E-37
sp|Q9QUM9|PSA6_MOUSE Proteasome subunit alpha type-6 OS=Mus musculus GN=Psma6 PE=1 SV=1 8 237 3.0E-37
sp|O73672|PSA2_CARAU Proteasome subunit alpha type-2 OS=Carassius auratus GN=psma2 PE=2 SV=3 8 236 5.0E-37
sp|Q9XG77|PSA6_TOBAC Proteasome subunit alpha type-6 OS=Nicotiana tabacum GN=PAA1 PE=2 SV=1 8 230 6.0E-37
sp|Q9NDA2|PSA7_TRYBB Proteasome subunit alpha type-7 OS=Trypanosoma brucei brucei GN=PSA4 PE=2 SV=1 8 208 6.0E-37
sp|P23639|PSA2_YEAST Proteasome subunit alpha type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE8 PE=1 SV=1 8 221 1.0E-36
sp|P24495|PSA2_XENLA Proteasome subunit alpha type-2 OS=Xenopus laevis GN=psma2 PE=2 SV=2 8 236 3.0E-36
sp|O70435|PSA3_MOUSE Proteasome subunit alpha type-3 OS=Mus musculus GN=Psma3 PE=1 SV=3 8 229 5.0E-36
sp|O16812|PSA73_DROVI Proteasome subunit alpha type-7-1B OS=Drosophila virilis GN=Pros28.1B PE=2 SV=1 6 172 6.0E-36
sp|Q58DU5|PSA3_BOVIN Proteasome subunit alpha type-3 OS=Bos taurus GN=PSMA3 PE=1 SV=3 8 229 8.0E-36
sp|P18422|PSA3_RAT Proteasome subunit alpha type-3 OS=Rattus norvegicus GN=Psma3 PE=1 SV=3 8 229 8.0E-36
sp|P25788|PSA3_HUMAN Proteasome subunit alpha type-3 OS=Homo sapiens GN=PSMA3 PE=1 SV=2 8 229 1.0E-35
sp|Q9XZJ4|PSA6_DROME Proteasome subunit alpha type-6 OS=Drosophila melanogaster GN=Prosalpha1 PE=1 SV=2 8 236 2.0E-35
sp|O42265|PSA1_CHICK Proteasome subunit alpha type-1 OS=Gallus gallus GN=PSMA1 PE=2 SV=2 12 240 2.0E-35
sp|O48551|PSA6_SOYBN Proteasome subunit alpha type-6 OS=Glycine max GN=PAA1 PE=2 SV=2 8 230 3.0E-35
sp|P92188|PSA1_TRYCR Proteasome subunit alpha type-1 OS=Trypanosoma cruzi PE=2 SV=1 3 232 4.0E-35
sp|P90513|PSA3_ACACA Proteasome subunit alpha type-3 (Fragment) OS=Acanthamoeba castellanii PE=2 SV=1 8 226 5.0E-35
sp|P21242|PSA7_YEAST Probable proteasome subunit alpha type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE10 PE=1 SV=2 8 183 1.0E-34
sp|O44156|PSA1_CAEEL Proteasome subunit alpha type-1 OS=Caenorhabditis elegans GN=pas-6 PE=1 SV=1 1 235 2.0E-34
sp|O81146|PSA6A_ARATH Proteasome subunit alpha type-6-A OS=Arabidopsis thaliana GN=PAA1 PE=1 SV=2 8 221 4.0E-34
sp|P40302|PSA6_YEAST Proteasome subunit alpha type-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE5 PE=1 SV=1 1 231 3.0E-33
sp|Q9VA12|PSA4L_DROME Proteasome subunit alpha type-4-like OS=Drosophila melanogaster GN=Prosalpha3T PE=2 SV=1 8 240 1.0E-32
sp|Q9LSU3|PSA6_ORYSJ Proteasome subunit alpha type-6 OS=Oryza sativa subsp. japonica GN=PAA1 PE=2 SV=1 4 224 2.0E-32
sp|O81147|PSA6B_ARATH Proteasome subunit alpha type-6-B OS=Arabidopsis thaliana GN=PAA2 PE=1 SV=1 8 224 2.0E-32
sp|O96788|PSA1_TRYBR Proteasome subunit alpha type-1 OS=Trypanosoma brucei rhodesiense PE=2 SV=1 3 232 4.0E-32
sp|Q27488|PSA2_CAEEL Proteasome subunit alpha type-2 OS=Caenorhabditis elegans GN=pas-2 PE=1 SV=1 8 230 1.0E-31
sp|O59770|PSA7_SCHPO Probable proteasome subunit alpha type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre10 PE=1 SV=1 8 221 5.0E-31
sp|O14250|PSA6_SCHPO Probable proteasome subunit alpha type-6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6G10.04c PE=3 SV=1 1 232 9.0E-31
sp|F4JJE5|PSA4B_ARATH Putative proteasome subunit alpha type-4-B OS=Arabidopsis thaliana GN=PAC2 PE=5 SV=1 8 221 6.0E-30
sp|O94517|PSA1_SCHPO Probable proteasome subunit alpha type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC646.16 PE=3 SV=1 8 241 3.0E-29
sp|Q54XM7|PSA6_DICDI Proteasome subunit alpha type-6 OS=Dictyostelium discoideum GN=psmA6 PE=3 SV=1 8 224 7.0E-28
sp|Q9V5C6|PSA3_DROME Proteasome subunit alpha type-3 OS=Drosophila melanogaster GN=Prosalpha7 PE=1 SV=1 8 183 9.0E-27
sp|O27270|PSB_METTH Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 34 242 3.0E-26
sp|O17586|PSA6_CAEEL Proteasome subunit alpha type-6 OS=Caenorhabditis elegans GN=pas-1 PE=1 SV=1 8 224 3.0E-24
sp|Q09583|PSA3_CAEEL Proteasome subunit alpha type-3 OS=Caenorhabditis elegans GN=pas-7 PE=1 SV=3 8 218 1.0E-23
sp|Q8SRU7|PSA3_ENCCU Probable proteasome subunit alpha type-3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE9 PE=1 SV=1 13 208 3.0E-23
sp|D3E0A3|PSB_METRM Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 34 242 1.0E-22
sp|P21243|PSA1_YEAST Proteasome subunit alpha type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCL1 PE=1 SV=1 8 241 3.0E-22
sp|A9A2U7|PSB2_NITMS Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 29 240 3.0E-22
sp|Q8ZST5|PSB2_PYRAE Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 29 239 7.0E-22
sp|A1RSJ8|PSB1_PYRIL Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 29 239 2.0E-21
sp|A5UM14|PSB_METS3 Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 34 242 3.0E-21
sp|Q8TW10|PSB_METKA Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 34 239 1.0E-20
sp|Q2NI68|PSB_METST Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 34 224 5.0E-20
sp|A4WMZ0|PSB2_PYRAR Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 29 208 5.0E-20
sp|B8D673|PSB1_DESK1 Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 31 224 1.0E-19
sp|A0RXV1|PSB2_CENSY Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 29 239 1.0E-19
sp|A3MXQ6|PSB2_PYRCJ Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 29 239 1.0E-19
sp|Q9GU37|PSA1_TRYBB Proteasome subunit alpha type-1 OS=Trypanosoma brucei brucei PE=2 SV=1 3 224 2.0E-19
sp|D5EAS6|PSB_METMS Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 34 242 4.0E-19
sp|B1YDJ0|PSB2_PYRNV Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 29 239 5.0E-19
sp|A1RWY6|PSB1_THEPD Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 34 224 1.0E-18
sp|A3DN27|PSB2_STAMF Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 35 203 2.0E-18
sp|Q3T0T1|PSB10_BOVIN Proteasome subunit beta type-10 OS=Bos taurus GN=PSMB10 PE=1 SV=1 30 198 2.0E-18
sp|Q12YV7|PSB_METBU Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 34 231 3.0E-18
sp|A8M8R5|PSB2_CALMQ Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 36 207 8.0E-18
sp|Q4KM35|PSB10_RAT Proteasome subunit beta type-10 OS=Rattus norvegicus GN=Psmb10 PE=2 SV=1 30 198 1.0E-17
sp|P40306|PSB10_HUMAN Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1 30 223 2.0E-17
sp|Q9P992|PSB_METTE Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 34 231 2.0E-17
sp|A1RX71|PSB2_THEPD Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 33 208 3.0E-17
sp|O35955|PSB10_MOUSE Proteasome subunit beta type-10 OS=Mus musculus GN=Psmb10 PE=1 SV=1 30 198 3.0E-17
sp|A3MS44|PSB1_PYRCJ Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 35 241 4.0E-17
sp|B8D683|PSB2_DESK1 Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 35 221 1.0E-16
sp|B1L6S7|PSB1_KORCO Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 34 242 1.0E-16
sp|A0B5B1|PSB_METTP Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 28 225 2.0E-16
sp|Q8PZ04|PSB_METMA Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 34 231 3.0E-16
sp|Q18GX3|PSB_HALWD Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 32 229 5.0E-16
sp|Q975U8|PSB1_SULTO Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 33 234 8.0E-16
sp|Q8TJB5|PSB_METAC Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 34 231 9.0E-16
sp|Q8ZYF2|PSB1_PYRAE Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 35 228 1.0E-15
sp|A1RTI7|PSB2_PYRIL Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 35 241 1.0E-15
sp|A3DN21|PSB1_STAMF Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 33 224 2.0E-15
sp|B1YA36|PSB1_PYRNV Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 35 241 2.0E-15
sp|Q46G14|PSB_METBF Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 34 238 2.0E-15
sp|D4GYZ1|PSB_HALVD Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 13 224 2.0E-15
sp|Q5V1D5|PSB2_HALMA Proteasome subunit beta 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB2 PE=3 SV=1 31 229 2.0E-15
sp|Q975D1|PSB2_SULTO Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 28 224 3.0E-15
sp|Q2FQL8|PSB_METHJ Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 34 232 3.0E-15
sp|D3RX66|PSB_FERPA Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 34 242 4.0E-15
sp|C3NE98|PSB1_SULIY Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 34 221 5.0E-15
sp|C3MVD5|PSB1_SULIM Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 34 221 5.0E-15
sp|C3MQ16|PSB1_SULIL Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 34 221 5.0E-15
sp|C4KHB0|PSB1_SULIK Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 34 221 5.0E-15
sp|D2PK63|PSB1_SULID Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 34 221 5.0E-15
sp|C3N5N4|PSB1_SULIA Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 34 221 5.0E-15
sp|Q9UXF3|PSB2_SULSO Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 34 221 6.0E-15
sp|D0KTH0|PSB2_SULS9 Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 34 221 7.0E-15
sp|C3NHF1|PSB2_SULIN Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 34 221 7.0E-15
sp|B8GG66|PSB_METPE Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 34 236 8.0E-15
sp|Q4JAA8|PSB2_SULAC Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 34 224 8.0E-15
sp|Q4JAY3|PSB1_SULAC Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 33 228 9.0E-15
sp|A8AB58|PSB2_IGNH4 Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 34 203 2.0E-14
sp|Q6L181|PSB_PICTO Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 28 232 3.0E-14
sp|Q5JHL8|PSB2_THEKO Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 32 224 4.0E-14
sp|A4WH05|PSB1_PYRAR Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 35 242 4.0E-14
sp|Q8U4C9|PSB1_PYRFU Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 32 224 5.0E-14
sp|B5IEE5|PSB_ACIB4 Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 44 227 5.0E-14
sp|A7I841|PSB_METB6 Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 34 225 5.0E-14
sp|A2SS78|PSB_METLZ Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 31 235 6.0E-14
sp|D2RGT4|PSB_ARCPA Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 34 232 1.0E-13
sp|A2BN24|PSB1_HYPBU Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 34 208 1.0E-13
sp|Q9V0N9|PSB2_PYRAB Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 34 241 1.0E-13
sp|Q980L4|PSB1_SULSO Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 33 228 1.0E-13
sp|D0KRX1|PSB1_SULS9 Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 33 228 1.0E-13
sp|O50110|PSB2_PYRHO Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 34 241 2.0E-13
sp|Q9YER0|PSB2_AERPE Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 31 209 2.0E-13
sp|Q97AZ7|PSB_THEVO Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 29 242 2.0E-13
sp|C5A2D5|PSB2_THEGJ Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 28 224 3.0E-13
sp|A6UT20|PSB_META3 Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 34 224 4.0E-13
sp|P28061|PSB_THEAC Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 29 242 4.0E-13
sp|Q9P996|PSB_ARCFU Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 29 228 5.0E-13
sp|A8MBW0|PSB1_CALMQ Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 44 228 5.0E-13
sp|B6YSW2|PSB1_THEON Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 34 240 6.0E-13
sp|C9REN7|PSB_METVM Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 34 232 7.0E-13
sp|C7P6N4|PSB_METFA Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 34 242 9.0E-13
sp|Q58634|PSB_METJA Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 34 242 1.0E-12
sp|Q0W2D6|PSB_METAR Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 34 239 1.0E-12
sp|A4FYA5|PSB_METM5 Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 25 242 2.0E-12
sp|Q8SQP9|PSA7_ENCCU Probable proteasome subunit alpha type-7 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE10 PE=1 SV=1 15 213 2.0E-12
sp|A8AA46|PSB1_IGNH4 Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 34 204 2.0E-12
sp|C5A7L1|PSB1_THEGJ Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 34 224 2.0E-12
sp|Q5JDJ9|PSB1_THEKO Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 34 240 3.0E-12
sp|C3N7K2|PSB2_SULIY Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 33 228 3.0E-12
sp|C3MY41|PSB2_SULIM Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 33 228 3.0E-12
sp|C3MRE5|PSB2_SULIL Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 33 228 3.0E-12
sp|C4KIR0|PSB2_SULIK Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 33 228 3.0E-12
sp|D2PDG6|PSB2_SULID Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 33 228 3.0E-12
sp|C3MZI0|PSB2_SULIA Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 33 228 3.0E-12
sp|C3NFX2|PSB1_SULIN Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 33 228 3.0E-12
sp|D1Z199|PSB_METPS Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 34 225 4.0E-12
sp|D3S8M7|PSB_METSF Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 34 242 5.0E-12
sp|C6A2V9|PSB1_THESM Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 26 208 5.0E-12
sp|A1XQU1|PSB7_PIG Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 6 225 7.0E-12
sp|Q6LZD4|PSB_METMP Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 25 242 1.0E-11
sp|Q9YES4|PSB1_AERPE Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 34 207 1.0E-11
sp|Q9V247|PSB1_PYRAB Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 32 224 1.0E-11
sp|C6A3R1|PSB2_THESM Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 32 224 2.0E-11
sp|A6VK02|PSB_METM7 Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 25 242 2.0E-11
sp|A9A788|PSB_METM6 Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 25 242 2.0E-11
sp|B1L6X8|PSB2_KORCO Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 35 222 3.0E-11
sp|Q9JHW0|PSB7_RAT Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 29 225 4.0E-11
sp|Q2TBP0|PSB7_BOVIN Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 6 225 4.0E-11
sp|A3CUS9|PSB_METMJ Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 31 225 4.0E-11
sp|P70195|PSB7_MOUSE Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 29 225 4.0E-11
sp|A4YJ04|PSB2_METS5 Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 32 224 5.0E-11
sp|A4YIE0|PSB1_METS5 Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 34 224 6.0E-11
sp|B9LTS6|PSB_HALLT Proteasome subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=psmB PE=3 SV=1 31 229 6.0E-11
sp|O57983|PSB1_PYRHO Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 32 224 8.0E-11
sp|Q99436|PSB7_HUMAN Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 32 225 1.0E-10
sp|O24361|PSB5_SPIOL Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1 22 203 1.0E-10
sp|A6USJ3|PSB_METVS Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 25 223 2.0E-10
sp|Q9HR36|PSB_HALSA Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmB PE=3 SV=2 4 224 2.0E-10
sp|B0R4C8|PSB_HALS3 Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmB PE=3 SV=1 4 224 2.0E-10
sp|Q9LIP2|PSB5B_ARATH Proteasome subunit beta type-5-B OS=Arabidopsis thaliana GN=PBE2 PE=1 SV=1 27 203 2.0E-10
sp|A2BN27|PSB2_HYPBU Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 28 231 4.0E-10
sp|O23717|PSB5A_ARATH Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1 34 203 5.0E-10
sp|P28064|PSB8_RAT Proteasome subunit beta type-8 OS=Rattus norvegicus GN=Psmb8 PE=1 SV=3 34 203 7.0E-10
sp|Q8U125|PSB2_PYRFU Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 34 240 1.0E-09
sp|P28063|PSB8_MOUSE Proteasome subunit beta type-8 OS=Mus musculus GN=Psmb8 PE=1 SV=2 34 203 1.0E-09
sp|Q8SQN7|PSB2_ENCCU Probable proteasome subunit beta type-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP1 PE=1 SV=1 32 241 2.0E-09
sp|P28075|PSB5_RAT Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 34 224 2.0E-09
sp|B6YXV3|PSB2_THEON Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 40 224 3.0E-09
sp|Q3T112|PSB8_BOVIN Proteasome subunit beta type-8 OS=Bos taurus GN=PSMB8 PE=1 SV=2 34 203 4.0E-09
sp|Q5W416|PSB8_CANLF Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 34 203 5.0E-09
sp|Q8UW64|PSB9_ORYLA Proteasome subunit beta type-9 OS=Oryzias latipes GN=psmb9 PE=3 SV=1 25 208 6.0E-09
sp|P34065|PSB5_CHICK Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 34 205 6.0E-09
sp|P25043|PSB2_YEAST Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 29 195 7.0E-09
sp|Q7DLS1|PSB7B_ARATH Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2 31 223 7.0E-09
sp|O23710|PSB7A_ARATH Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2 31 223 8.0E-09
sp|P28062|PSB8_HUMAN Proteasome subunit beta type-8 OS=Homo sapiens GN=PSMB8 PE=1 SV=3 34 203 9.0E-09
sp|O55234|PSB5_MOUSE Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 34 224 1.0E-08
sp|Q32KL2|PSB5_BOVIN Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 34 224 2.0E-08
sp|Q9PT26|PSB9_ONCMY Proteasome subunit beta type-9 OS=Oncorhynchus mykiss GN=psmb9 PE=2 SV=1 29 228 3.0E-08
sp|Q9DD33|PSB9_SALSA Proteasome subunit beta type-9 OS=Salmo salar GN=psmb9-a PE=2 SV=1 29 228 4.0E-08
sp|Q09841|PSB2_SCHPO Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 29 208 4.0E-08
sp|P30655|PSB5_SCHPO Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pts1 PE=3 SV=3 34 203 9.0E-08
sp|Q5R8S2|PSB5_PONAB Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 34 224 1.0E-07
sp|P28074|PSB5_HUMAN Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 34 224 1.0E-07
sp|P30656|PSB5_YEAST Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 31 224 1.0E-07
sp|Q54BC8|PSB5_DICDI Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 34 224 2.0E-07
sp|Q8LD27|PSB6_ARATH Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 32 204 4.0E-07
sp|Q60692|PSB6_MOUSE Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 15 228 8.0E-07
sp|A9A4A1|PSB1_NITMS Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 34 234 2.0E-06
sp|P28073|PSB6_RAT Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 15 228 2.0E-06
sp|P28072|PSB6_HUMAN Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 15 228 5.0E-06
sp|Q3SZC2|PSB9_BOVIN Proteasome subunit beta type-9 OS=Bos taurus GN=PSMB9 PE=1 SV=1 31 222 8.0E-06
sp|Q55GJ6|PSB6_DICDI Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1 25 195 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005839 proteasome core complex Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0051603 proteolysis involved in protein catabolic process Yes
GO:0019773 proteasome core complex, alpha-subunit complex Yes
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0009056 catabolic process No
GO:0044238 primary metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0044248 cellular catabolic process No
GO:0006508 proteolysis No
GO:1901575 organic substance catabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|002130
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTTVGIKTPDGVILGVEKRVQSPLLEASSIEKIMEIDNHLG
CAMSGLTADARTMIDHARVTAQNHAFTYDERIKVESVTQAVCDLALRFGESVHDEEAMMSRPFGVALLIAGIDEH
GPQLFHTDPSGTFVRYEAKAIGSGSEAAQSELQDKWHKQMTLKEAQVLTLRVLKQVMEEKLDQHNVQLAQVTKDK
GFEILDEARLQAVIEEM*
Coding >Agabi119p4|002130
ATGTTCCTTACACGCTCAGAATACGATCGCGGTGTCAATACTTTCTCCCCAGAAGGCCGTCTATTCCAAGTTGAA
TATGCCATCGAGGCCATTAAACTAGGTTCAACTACTGTTGGAATCAAGACGCCCGATGGTGTAATTCTTGGTGTA
GAAAAGCGCGTCCAATCTCCCCTCCTTGAAGCCTCCTCAATCGAAAAGATCATGGAAATCGACAATCATCTTGGT
TGTGCCATGTCAGGTCTTACCGCTGATGCTCGTACGATGATCGACCATGCGCGTGTTACAGCTCAAAATCATGCC
TTTACCTATGACGAACGTATCAAAGTTGAGAGTGTGACTCAGGCTGTGTGTGATCTCGCACTACGATTCGGTGAA
AGTGTGCATGATGAAGAGGCAATGATGAGCCGTCCGTTCGGTGTTGCATTGCTGATTGCTGGTATTGATGAACAT
GGACCCCAGTTATTCCATACTGACCCTTCAGGCACCTTCGTACGATATGAGGCAAAAGCAATCGGGTCAGGGTCA
GAAGCCGCCCAGAGCGAATTACAAGATAAGTGGCATAAACAAATGACGTTAAAAGAAGCTCAAGTTTTGACGCTG
CGTGTATTGAAACAAGTGATGGAAGAGAAGCTTGATCAACACAACGTTCAACTGGCACAGGTGACAAAAGATAAA
GGGTTTGAGATTCTAGATGAGGCACGACTACAAGCAGTAATAGAAGAAATGTAA
Transcript >Agabi119p4|002130
ATGTTCCTTACACGCTCAGAATACGATCGCGGTGTCAATACTTTCTCCCCAGAAGGCCGTCTATTCCAAGTTGAA
TATGCCATCGAGGCCATTAAACTAGGTTCAACTACTGTTGGAATCAAGACGCCCGATGGTGTAATTCTTGGTGTA
GAAAAGCGCGTCCAATCTCCCCTCCTTGAAGCCTCCTCAATCGAAAAGATCATGGAAATCGACAATCATCTTGGT
TGTGCCATGTCAGGTCTTACCGCTGATGCTCGTACGATGATCGACCATGCGCGTGTTACAGCTCAAAATCATGCC
TTTACCTATGACGAACGTATCAAAGTTGAGAGTGTGACTCAGGCTGTGTGTGATCTCGCACTACGATTCGGTGAA
AGTGTGCATGATGAAGAGGCAATGATGAGCCGTCCGTTCGGTGTTGCATTGCTGATTGCTGGTATTGATGAACAT
GGACCCCAGTTATTCCATACTGACCCTTCAGGCACCTTCGTACGATATGAGGCAAAAGCAATCGGGTCAGGGTCA
GAAGCCGCCCAGAGCGAATTACAAGATAAGTGGCATAAACAAATGACGTTAAAAGAAGCTCAAGTTTTGACGCTG
CGTGTATTGAAACAAGTGATGGAAGAGAAGCTTGATCAACACAACGTTCAACTGGCACAGGTGACAAAAGATAAA
GGGTTTGAGATTCTAGATGAGGCACGACTACAAGCAGTAATAGAAGAAATGTAA
Gene >Agabi119p4|002130
ATGTTCCTTACACGCTCAGAATACGGTAAGTGTATTTGATTTTCAGATAGACATAGAACTGAATATCTATGCCTC
AGATCGCGGTGTCAATACTTTCTCCCCAGAAGGCCGTCTATTCCAAGGTACTTGAACAATTTAAATTCAGTGTCG
TGCTCATTCAACGCGATCGTACAGTTGAATATGCCATCGAGGCCATTAAAGTATGTCTTGAGGACATGGGTACAA
AATTGAACCTTATACGCTCTCTCCGCAGCTAGGTTCAACTACTGTTGGAATCAAGACGCCCGATGGTGTAATTCT
TGGTGTAGAAAAGCGCGTCCAATCTCCCCTCCTTGAAGCCTCCTCAATCGAAAAGATCATGGAAATCGACAATCA
TCTTGGTTGTGCCATGTCAGGTCTTACCGCTGATGCTCGTACGATGATCGACCATGCGCGTGTTACAGCTCAAAA
TCATGCCTTTACCTATGACGAACGTATCAAAGTTGAGAGTGTGACTCAGGCTGTGTGTGATCTCGCACTACGATT
CGGTGAAAGTGTGCATGATGAAGAGGCAATGATGAGCCGTCCGTTCGGTGTTGCATTGCTGATTGCTGGTATTGA
TGAACATGGACCCCAGTTGTACGTGCTTCCCCTTGTCATATCATCTATGGTTCCGTGTTTACTGAAATTCAAGGT
GTTGATAGATTCCATACTGACCCTTCAGGCACCTTCGTACGATATGAGGCAAAAGCAATCGGGTCAGGGTCAGAA
GCCGCCCAGAGCGAATTACAAGATAAGTGGCATAAAGTATGTATCTTCGTACCTGCTTTGTGATATTCTAAGTAA
TGGCTCTCCGCAGCAAATGACGTTAAAAGAAGCTCAAGTTTTGACGCTGCGTGTATTGAAACAAGTGATGGAAGA
GAAGCTTGATCAACACAACGTTCAACTGGCACAGGTATATTGGTCTAGAACTTCCTCATTATTACCATGAGGGCT
GATGGTCCCACAATTAGGTGACAAAAGATAAAGGGTTTGAGATTCTAGATGAGGCACGACTACAAGCAGTAATAG
AAGAAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail