Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|001890
Gene name
Locationscaffold_01a:497497..498024
Strand-
Gene length (bp)527
Transcript length (bp)360
Coding sequence length (bp)360
Protein length (aa) 120

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 4.6E-08 26 116

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 68 119 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|001890
MSLTKYLLTLFLSALMVGSYSVVATHTGLASWYNPDLVACGRIISNGELVTALNQEDFSDFENCDRIVQVNYQGR
SIRVQVVDECFGCGLGGMDLSQAAFELLTGNLGLGIVPIEWEYV*
Coding >Agabi119p4|001890
ATGAGTTTAACCAAATATCTACTCACACTTTTCCTTTCCGCTTTGATGGTGGGAAGTTATAGTGTTGTCGCCACT
CATACTGGTTTGGCGTCTTGGTACAATCCTGATCTAGTGGCGTGCGGCCGCATAATTTCTAATGGGGAACTGGTA
ACCGCTTTGAATCAGGAGGATTTTAGTGATTTTGAAAATTGCGATCGCATCGTCCAAGTTAATTATCAAGGGCGC
TCTATCAGGGTTCAAGTGGTTGACGAGTGTTTCGGATGCGGTCTTGGAGGCATGGATTTATCTCAGGCAGCTTTT
GAATTGCTTACTGGTAATTTGGGATTAGGGATTGTTCCGATAGAATGGGAATATGTCTAG
Transcript >Agabi119p4|001890
ATGAGTTTAACCAAATATCTACTCACACTTTTCCTTTCCGCTTTGATGGTGGGAAGTTATAGTGTTGTCGCCACT
CATACTGGTTTGGCGTCTTGGTACAATCCTGATCTAGTGGCGTGCGGCCGCATAATTTCTAATGGGGAACTGGTA
ACCGCTTTGAATCAGGAGGATTTTAGTGATTTTGAAAATTGCGATCGCATCGTCCAAGTTAATTATCAAGGGCGC
TCTATCAGGGTTCAAGTGGTTGACGAGTGTTTCGGATGCGGTCTTGGAGGCATGGATTTATCTCAGGCAGCTTTT
GAATTGCTTACTGGTAATTTGGGATTAGGGATTGTTCCGATAGAATGGGAATATGTCTAG
Gene >Agabi119p4|001890
ATGAGTTTAACCAAATATCTACTCACACTTTTCCTTTCCGCTTTGATGGTGGGAAGTTATAGTGTTGTCGCCACT
CATACTGGTTTGGGTAAGCCTTCAATCCAAACTCAAGTTGTTGAGCGTCTTGAGTAATTCATCACGCAGCGTCTT
GGTACAATCCTGATGTAAGTATATGTAGTGTGTTATCTTGCTCCTAGTTCCACAAACACTTTCTATTCTTTAGCT
AGTGGCGTGCGGCCGCATAATTTCTAATGGGGAACTGGTAACCGCTTTGAATCAGGAGGATTTTAGTGATTTTGA
AAATTGCGATCGCATCGTCCAAGTTAATTGTAGGTTAACAGCATTATCATGAAAAGTTGAATCTAACAGCGGACG
TTGTAGATCAAGGGCGCTCTATCAGGGTTCAAGTGGTTGACGAGTGTTTCGGATGCGGTCTTGGAGGCATGGATT
TATCTCAGGCAGCTTTTGAATTGCTTACTGGTAATTTGGGATTAGGGATTGTTCCGATAGAATGGGAATATGTCT
AG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail