Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|001570
Gene name
Locationscaffold_01a:429258..430551
Strand-
Gene length (bp)1293
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00294 PfkB pfkB family carbohydrate kinase 6.2E-61 29 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93919|ADK_SCHCO Adenosine kinase OS=Schizophyllum commune GN=ADK PE=2 SV=1 9 349 2.0E-133
sp|P47143|ADK_YEAST Adenosine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADO1 PE=1 SV=1 12 347 1.0E-85
sp|P78825|ADK_SCHPO Adenosine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ado1 PE=2 SV=2 12 345 6.0E-84
sp|Q64640|ADK_RAT Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 SV=3 12 338 2.0E-77
sp|P55264|ADK_MOUSE Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2 12 338 8.0E-75
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93919|ADK_SCHCO Adenosine kinase OS=Schizophyllum commune GN=ADK PE=2 SV=1 9 349 2.0E-133
sp|P47143|ADK_YEAST Adenosine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADO1 PE=1 SV=1 12 347 1.0E-85
sp|P78825|ADK_SCHPO Adenosine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ado1 PE=2 SV=2 12 345 6.0E-84
sp|Q64640|ADK_RAT Adenosine kinase OS=Rattus norvegicus GN=Adk PE=1 SV=3 12 338 2.0E-77
sp|P55264|ADK_MOUSE Adenosine kinase OS=Mus musculus GN=Adk PE=1 SV=2 12 338 8.0E-75
sp|O49923|ADK_PHYPA Adenosine kinase OS=Physcomitrella patens subsp. patens GN=ADK PE=2 SV=1 12 338 9.0E-75
sp|P55262|ADK_CRIGR Adenosine kinase OS=Cricetulus griseus GN=ADK PE=1 SV=2 12 338 9.0E-74
sp|Q54MB5|ADK_DICDI Adenosine kinase OS=Dictyostelium discoideum GN=adk PE=3 SV=2 11 338 6.0E-73
sp|P55263|ADK_HUMAN Adenosine kinase OS=Homo sapiens GN=ADK PE=1 SV=2 12 338 1.0E-72
sp|Q9LZG0|ADK2_ARATH Adenosine kinase 2 OS=Arabidopsis thaliana GN=ADK2 PE=1 SV=1 1 341 9.0E-72
sp|Q9SF85|ADK1_ARATH Adenosine kinase 1 OS=Arabidopsis thaliana GN=ADK1 PE=1 SV=1 12 341 3.0E-71
sp|Q9TVW2|ADK_TOXGO Adenosine kinase OS=Toxoplasma gondii GN=AK PE=1 SV=1 11 343 5.0E-33
sp|Q55480|YZ37_SYNY3 Uncharacterized sugar kinase slr0537 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0537 PE=3 SV=1 12 340 2.0E-11
sp|O29891|Y356_ARCFU Uncharacterized sugar kinase AF_0356 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0356 PE=3 SV=1 86 345 5.0E-08
sp|O60116|RBSK_SCHPO Putative ribokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16G5.02c PE=3 SV=1 65 346 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|001570
MASTTTPESTKLFCLGNPLLDIQVLNGEHYLEKYGLKSDDAILAEDKHMPIYDEIVKDKVIYVAGGASQNTARGA
AYILPPNSVVYAGCVGNDDFHTQLQSANNREGVQSLYQIKTDDKTGACAVIITGHDRSLVTTLRSAEKLELGHLE
SEGVLPFIEAASVIYVEGYFLTHGTEIVEWLSKKASASNKTFIMNLSAPFIAQFFTSNIQKILPHIDILIGNESE
ASAWATATNYPGSPTDLQGIAQSLSTSTKSNTLRKRTVIFTHGDQETVVVAGPNEKAINVPVNPLTKDEIVDTNG
AGDAFAGGFVAGYILKKGLEESVLLGHQLAAMCVQQSGPQYKFPKVNLL*
Coding >Agabi119p4|001570
ATGGCATCAACAACCACTCCTGAATCTACAAAACTATTCTGTCTCGGTAATCCTTTACTTGACATTCAAGTCCTT
AACGGTGAACACTATTTGGAAAAATATGGATTGAAGTCGGATGATGCGATTTTGGCTGAAGATAAACATATGCCG
ATTTATGATGAGATTGTGAAAGATAAGGTTATCTATGTTGCTGGTGGTGCTTCACAAAACACAGCTCGAGGAGCC
GCCTACATCCTCCCCCCCAACTCAGTAGTCTACGCCGGCTGCGTCGGCAACGACGATTTCCATACTCAACTCCAA
TCCGCCAACAACCGCGAAGGTGTCCAAAGTCTCTACCAAATCAAAACCGACGATAAAACAGGCGCTTGTGCTGTG
ATCATCACTGGACATGATCGATCTCTTGTTACTACTTTGAGAAGTGCTGAGAAATTGGAATTGGGGCATTTGGAA
TCGGAGGGGGTGTTGCCGTTTATTGAAGCTGCTTCTGTGATTTATGTGGAAGGTTATTTTTTGACTCATGGGACT
GAGATTGTGGAATGGTTGAGTAAGAAAGCTTCTGCTTCCAACAAGACATTCATAATGAACCTTTCCGCACCTTTC
ATCGCTCAATTCTTCACTTCCAACATCCAAAAAATTCTTCCTCACATCGATATCCTCATCGGTAACGAATCCGAA
GCCTCCGCCTGGGCAACCGCAACCAACTACCCCGGCTCCCCCACCGATCTCCAAGGTATAGCCCAATCCCTCTCC
ACCTCCACCAAATCCAACACCCTCCGCAAACGCACGGTCATCTTCACCCACGGTGATCAAGAAACCGTCGTCGTA
GCTGGACCCAATGAAAAAGCTATAAATGTCCCGGTAAATCCACTTACGAAGGATGAGATTGTCGATACGAATGGG
GCTGGAGATGCGTTTGCGGGTGGGTTTGTGGCGGGGTATATTTTGAAAAAGGGGTTGGAGGAGAGTGTGCTTCTT
GGTCATCAACTTGCGGCTATGTGTGTTCAACAGAGTGGACCTCAATACAAGTTTCCCAAAGTCAACCTCCTTTAA
Transcript >Agabi119p4|001570
ATGGCATCAACAACCACTCCTGAATCTACAAAACTATTCTGTCTCGGTAATCCTTTACTTGACATTCAAGTCCTT
AACGGTGAACACTATTTGGAAAAATATGGATTGAAGTCGGATGATGCGATTTTGGCTGAAGATAAACATATGCCG
ATTTATGATGAGATTGTGAAAGATAAGGTTATCTATGTTGCTGGTGGTGCTTCACAAAACACAGCTCGAGGAGCC
GCCTACATCCTCCCCCCCAACTCAGTAGTCTACGCCGGCTGCGTCGGCAACGACGATTTCCATACTCAACTCCAA
TCCGCCAACAACCGCGAAGGTGTCCAAAGTCTCTACCAAATCAAAACCGACGATAAAACAGGCGCTTGTGCTGTG
ATCATCACTGGACATGATCGATCTCTTGTTACTACTTTGAGAAGTGCTGAGAAATTGGAATTGGGGCATTTGGAA
TCGGAGGGGGTGTTGCCGTTTATTGAAGCTGCTTCTGTGATTTATGTGGAAGGTTATTTTTTGACTCATGGGACT
GAGATTGTGGAATGGTTGAGTAAGAAAGCTTCTGCTTCCAACAAGACATTCATAATGAACCTTTCCGCACCTTTC
ATCGCTCAATTCTTCACTTCCAACATCCAAAAAATTCTTCCTCACATCGATATCCTCATCGGTAACGAATCCGAA
GCCTCCGCCTGGGCAACCGCAACCAACTACCCCGGCTCCCCCACCGATCTCCAAGGTATAGCCCAATCCCTCTCC
ACCTCCACCAAATCCAACACCCTCCGCAAACGCACGGTCATCTTCACCCACGGTGATCAAGAAACCGTCGTCGTA
GCTGGACCCAATGAAAAAGCTATAAATGTCCCGGTAAATCCACTTACGAAGGATGAGATTGTCGATACGAATGGG
GCTGGAGATGCGTTTGCGGGTGGGTTTGTGGCGGGGTATATTTTGAAAAAGGGGTTGGAGGAGAGTGTGCTTCTT
GGTCATCAACTTGCGGCTATGTGTGTTCAACAGAGTGGACCTCAATACAAGTTTCCCAAAGTCAACCTCCTTTAA
Gene >Agabi119p4|001570
ATGGCATCAACAACCACTCCTGAATCTACAAAACTATTCTGTCTCGGTAATCCTTTACTTGACATTCAAGTCCTT
AACGGTGAACACTATTTGGAAAAATATGGATTGAAGTCGGATGATGCGATTTTGGCTGAAGATAAACATATGCCG
ATGTACGTTGCAAACAAAAAAAAAAAAAAAAAGTTATTGAGTATTGAATGTTGATCATCTTTGTTAGTTATGATG
AGATTGTGAAAGATAAGGTTATCTATGTTGCTGGTGGTGCTTCACAAAACACAGCTCGAGGAGCCGCCGTACGTT
TTCTCACTTCTTATTCTCTTATCTCACCCTTACCCAATAACCAATCCCTAATAGTACATCCTCCCCCCCAACTCA
GTAGTCTACGCCGGCTGCGTCGGCAACGACGATTTCCATACTCAACTCCAATCCGCCAACAACCGCGAAGGTGTC
CAAAGTCTCTACCAAATCAAAACCGACGATAAAACAGGCGCTTGTGCTGTGATCATCACTGGACATGATCGATCT
CTTGTTACTACTTTGAGAAGTGCTGAGAAATTGGAATTGGGGCATTTGGAATCGGAGGGGGTGTTGCCGTTTATT
GAAGCTGCTTCTGTGATTTATGTGGAAGGTTATTTTTTGACTCATGGGACTGAGATTGTGGAATGGTTGAGTAAG
AAAGCTTCTGCTTCCAACAAGGTCAATTTCAGTTCAGCCCAACACTCTCAAAAAGTTTTTCTAAAAACATCGAGT
TCTTTTGTAGACATTCATAATGAACCTTTCCGCACCTTTCATCGCTCAATTCTTCACTTCCAACATCCAAAAAAT
TCTTCCTCACATCGATATCCTCATCGGTAACGAATCCGAAGCCTCCGCCTGGGCAACCGCAACCAACTACCCCGG
CTCCCCCACCGATCTCCAAGGTATAGCCCAATCCCTCTCCACCTCCACCAAATCCAACACCCTCCGCAAACGCAC
GGTCATCTTCACCCACGGTGATCAAGAAACCGTCGTCGTAGCTGGACCCAATGAAAAAGCTATAAATGTCCCGGT
AAATCCACTTACGAAGGATGAGATTGTCGATACGAATGGGGCTGGAGATGCGTTTGCGGGTGGGTTTGTGGCGGG
GTATATTTTGAAAAAGGGGTTGGAGGAGAGTGTGCTTCTTGGTCATCAACTTGCGGCTATGTGTGTTCAACAGGT
ATGTTTTTCTCTTTGCTGTTCTAAGATGTTTATTGAAATAATCATTATTAGAGTGGACCTCAATACAAGTTTCCC
AAAGTCAACCTCCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail