Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|001400
Gene name
Locationscaffold_01a:378390..379770
Strand+
Gene length (bp)1380
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 1.4E-04 4 59
PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat 1.4E-05 389 439

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42645|YF94_SCHPO RCC1 repeat-containing protein C10F6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.04 PE=3 SV=1 4 402 3.0E-09
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 4 446 1.0E-06
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 114 416 2.0E-06
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 45 450 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|001400
MLNLLSAGSNAQGQLGNSTIDDSHTFRVCSFAGSLPETLPPSVTNVIDVTNGSNHTLALLEVMIDGKKSTEVWGC
GDGRKGQLGPIYKRRHTDQGSTTIFQNLAFADAFDKLGLGGYTITTIGTTWETSYLALQKLGKRDLIVSFGSNDF
GDLGVGKDSGDKTVEKGLGIHVVNFSHIAVGGKSIRSAQSVTVEKLRTGQRHAIASLQVVWAGKEPMQILVGWGA
FRHGQLGTVPPSSKPFLTSTISKSSPTTPLEPTYHSRPTLIMSLAAPSDFVTEYSLGIHHSVFLHASGHVSFRGS
NRKNQTQGLDACRNICDIKCTWNGSYMLTKDNPPHVLSTGSNSHGQLGRAEDSSSWKVEVPIDEDSKAIRTLACG
SEHSLVCVVNEQGDDEVWGWGWNEHGNLGVGHTLDAPAPLKMWPPAQLPENIEPHPVRNVWAGTGSSWILCGNTD
GTVEKTTSM*
Coding >Agabi119p4|001400
ATGTTAAACCTGTTATCCGCAGGTTCAAATGCACAAGGCCAACTGGGTAACTCAACCATCGACGACTCTCATACC
TTCAGAGTCTGTTCTTTTGCCGGATCACTACCCGAAACTCTACCCCCTAGTGTCACCAATGTCATAGACGTGACG
AACGGATCCAATCATACGCTCGCCCTCCTGGAAGTCATGATCGACGGCAAAAAATCCACGGAGGTATGGGGATGT
GGTGATGGGAGAAAGGGCCAACTGGGTCCAATATATAAGCGGCGACATACCGATCAAGGCTCTACCACGATATTC
CAGAATTTGGCTTTTGCTGATGCCTTTGACAAACTAGGTTTGGGAGGCTACACGATCACCACCATCGGAACCACA
TGGGAGACATCCTATTTGGCCCTTCAGAAGCTAGGGAAACGCGATCTTATCGTATCCTTTGGGTCAAATGACTTT
GGCGATCTCGGAGTTGGGAAGGATTCTGGGGACAAAACTGTGGAAAAGGGGCTCGGAATTCATGTCGTCAATTTC
TCCCATATCGCTGTTGGAGGAAAATCCATTAGATCCGCTCAGAGCGTGACAGTTGAGAAACTACGAACTGGTCAA
AGACACGCCATTGCTTCACTGCAAGTCGTTTGGGCCGGCAAGGAGCCTATGCAGATCCTGGTCGGTTGGGGTGCC
TTCAGACATGGACAACTCGGTACTGTACCACCCTCTTCCAAACCCTTCCTTACGTCTACCATCTCGAAGTCAAGC
CCTACCACGCCTTTAGAGCCCACTTATCATTCTCGACCCACCCTCATCATGTCCCTTGCTGCTCCCTCGGATTTT
GTCACCGAATATTCCCTAGGAATCCATCATAGCGTATTTCTACATGCATCTGGGCATGTCTCCTTCCGGGGTTCA
AATCGAAAAAATCAGACTCAAGGATTGGATGCTTGTCGCAACATTTGTGACATCAAATGTACGTGGAATGGATCC
TATATGCTTACCAAGGACAATCCGCCCCACGTCCTTTCCACCGGGAGTAATTCACATGGTCAGCTAGGGAGGGCG
GAAGATTCGAGCAGTTGGAAGGTCGAAGTGCCCATTGACGAAGACAGCAAAGCCATCAGAACGCTGGCTTGCGGA
AGCGAGCATTCACTTGTTTGCGTCGTCAACGAGCAGGGAGATGACGAAGTCTGGGGTTGGGGTTGGAACGAACAC
GGAAATCTTGGTGTCGGGCATACCCTCGACGCGCCAGCACCGTTGAAAATGTGGCCCCCAGCACAACTGCCAGAG
AACATTGAGCCTCATCCCGTACGCAACGTTTGGGCAGGTACGGGTTCGAGTTGGATTCTTTGCGGAAATACAGAC
GGTACGGTCGAGAAAACGACATCCATGTAG
Transcript >Agabi119p4|001400
ATGTTAAACCTGTTATCCGCAGGTTCAAATGCACAAGGCCAACTGGGTAACTCAACCATCGACGACTCTCATACC
TTCAGAGTCTGTTCTTTTGCCGGATCACTACCCGAAACTCTACCCCCTAGTGTCACCAATGTCATAGACGTGACG
AACGGATCCAATCATACGCTCGCCCTCCTGGAAGTCATGATCGACGGCAAAAAATCCACGGAGGTATGGGGATGT
GGTGATGGGAGAAAGGGCCAACTGGGTCCAATATATAAGCGGCGACATACCGATCAAGGCTCTACCACGATATTC
CAGAATTTGGCTTTTGCTGATGCCTTTGACAAACTAGGTTTGGGAGGCTACACGATCACCACCATCGGAACCACA
TGGGAGACATCCTATTTGGCCCTTCAGAAGCTAGGGAAACGCGATCTTATCGTATCCTTTGGGTCAAATGACTTT
GGCGATCTCGGAGTTGGGAAGGATTCTGGGGACAAAACTGTGGAAAAGGGGCTCGGAATTCATGTCGTCAATTTC
TCCCATATCGCTGTTGGAGGAAAATCCATTAGATCCGCTCAGAGCGTGACAGTTGAGAAACTACGAACTGGTCAA
AGACACGCCATTGCTTCACTGCAAGTCGTTTGGGCCGGCAAGGAGCCTATGCAGATCCTGGTCGGTTGGGGTGCC
TTCAGACATGGACAACTCGGTACTGTACCACCCTCTTCCAAACCCTTCCTTACGTCTACCATCTCGAAGTCAAGC
CCTACCACGCCTTTAGAGCCCACTTATCATTCTCGACCCACCCTCATCATGTCCCTTGCTGCTCCCTCGGATTTT
GTCACCGAATATTCCCTAGGAATCCATCATAGCGTATTTCTACATGCATCTGGGCATGTCTCCTTCCGGGGTTCA
AATCGAAAAAATCAGACTCAAGGATTGGATGCTTGTCGCAACATTTGTGACATCAAATGTACGTGGAATGGATCC
TATATGCTTACCAAGGACAATCCGCCCCACGTCCTTTCCACCGGGAGTAATTCACATGGTCAGCTAGGGAGGGCG
GAAGATTCGAGCAGTTGGAAGGTCGAAGTGCCCATTGACGAAGACAGCAAAGCCATCAGAACGCTGGCTTGCGGA
AGCGAGCATTCACTTGTTTGCGTCGTCAACGAGCAGGGAGATGACGAAGTCTGGGGTTGGGGTTGGAACGAACAC
GGAAATCTTGGTGTCGGGCATACCCTCGACGCGCCAGCACCGTTGAAAATGTGGCCCCCAGCACAACTGCCAGAG
AACATTGAGCCTCATCCCGTACGCAACGTTTGGGCAGGTACGGGTTCGAGTTGGATTCTTTGCGGAAATACAGAC
GGTACGGTCGAGAAAACGACATCCATGTAG
Gene >Agabi119p4|001400
ATGTTAAACCTGTTATCCGCAGGTTCAAATGCACAAGGCCAACTGGGTAACTCAACCATCGACGACTCTCATACC
TTCAGAGTCTGTTCTTTTGCCGGATCACTACCCGAAACTCTACCCCCTAGTGTCACCAATGTCATAGACGTGACG
AACGGATCCAATCATACGCTCGCCCTCCTGGAAGTCATGATCGACGGCAAAAAATCCACGGAGGTATGGGGATGT
GGTGATGGGAGAAAGGGCCAACTGGGTCCAATATATAAGCGGCGACATACCGATCAAGGCTCTACCACGATATTC
CAGAATTTGGCTTTTGCTGATGCCTTTGACAAACTAGGTTTGGGAGGCTACACGATCACCACCATCGGAACCACA
TGGGAGACATCCTATTTGGCCCTTCAGAAGCTAGGGAAACGCGATCTTATCGTATCCTTTGGGTCAAATGACTTT
GGCGATCTCGGAGTTGGGAAGGATTCTGGGGACAAAACTGTGGAAAAGGGGCTCGGAATTCATGTCGTCAATTTC
TCCCATATCGCTGTTGGAGGAAAATCCATTAGATCCGCTCAGAGCGTGACAGTTGAGAAACTACGAACTGGTCAA
AGACACGCCATTGCTTCACTGCAAGTCGTTTGGGCCGGCAAGGAGCCTATGCAGATCCTGGTCGGTTGGGGTGCC
TTCAGACATGGACAACTCGGTACTGTACCACCCTCTTCCAAACCCTTCCTTACGTCTACCATCTCGAAGTCAAGC
CCTACCACGCCTTTAGAGCCCACTTATCATTCTCGACCCACCCTCATCATGTCCCTTGCTGCTCCCTCGGATTTT
GTCACCGAATATTCCCTAGGAATCCATCATAGCGTATTTCTACATGCATCTGGGCATGTCTCCTTCCGGGGTTCA
AATCGAAAAAATCAGACTCAAGGATTGGATGCTTGTCGCAACATTTGTGACATCAAATGTACGTGGAATGGATCC
TATATGCTTACCAAGGACAATCCGCCCCACGTCCTTTCCACCGGGAGTAATTCACATGGTCAGCTAGGGAGGGCG
GAAGATTCGAGCAGTTGGAAGGTCGAAGTGCCCATTGACGAAGACAGCAAAGCCATCAGAACGCTGGCTTGCGGA
AGCGAGCATTCACTTGTTTGCGTCGTCAACGAGCAGGGAGATGACGAAGTCTGGGGTTGGGGTTGGAACGAACAC
GGAAATCTTGGTGTCGGGCATACCCTCGACGCGCCAGCACCGTTGAAAATGTGGCCCCCAGCACAACTGCCAGAG
AACATTGAGCCTCATCCCGTACGCAACGTTTGGGCAGGTACGGGTTCGAGTTGGATTCTTTGCGGAAATACAGAC
GGTACGGTCGAGAAAACGACATCCATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail