Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|001090
Gene name
Locationscaffold_01a:252673..254400
Strand-
Gene length (bp)1727
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 1.1E-17 65 378

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40896|YJV3_YEAST Uncharacterized protein YJL213W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL213W PE=4 SV=1 94 318 7.0E-15
sp|P68916|Y2939_MYCBO Uncharacterized protein Mb2939c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2939c PE=4 SV=1 66 388 6.0E-06
sp|P9WL23|Y2915_MYCTU Uncharacterized protein Rv2915c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2915c PE=1 SV=1 66 388 6.0E-06
sp|P9WL22|Y2915_MYCTO Uncharacterized protein MT2982.1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2982.1 PE=4 SV=1 66 388 6.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|001090
MPKTEVLAILAGKLFNSQKRCILEDQVIMIDQELGVILGVLNLGVFKRLHGKDDGIDFMDLGHLTIIPGLVDVHV
HLFLHAYAETPWNDQVTKESLAERTIRATVHARRTLMAGFTTVRDLGTEGALDADISLRKCLSGREPMISGPRYY
CANRAIVTTGAYGPRSSLYPSSRGVEGVMGAEPVDGVDGCIREVRKQVGVGADWVKIYADYRVRAAMQDVSPSLS
SKSIPTFNRQELEVMITTAHDLGVKVAAHANSWAAVEDLLDLGVDTIEHGAEIYNDQDQNISLIKKLAASKGKTT
WVPTLAAYHTLGKSRWEAVKQTFVKAVIEEGVENIACGGDTGVFSHGENALELILMRQLGVPWEKVISWATLGGW
ECVRGFEWEGSRGRQRIRDLEANPRRVSDVDRGIPFGTIRKGWAADIVGIDGDLTGSPEEFEKSLTMGVKLVIKN
GNIVKRVGK*
Coding >Agabi119p4|001090
ATGCCCAAAACAGAAGTTTTGGCGATCCTAGCAGGAAAACTATTTAACTCGCAGAAGCGATGTATACTGGAGGAT
CAAGTGATCATGATAGATCAAGAACTGGGCGTCATCCTTGGTGTTCTGAACCTTGGCGTTTTCAAAAGATTGCAC
GGAAAAGATGACGGTATAGACTTTATGGATCTAGGGCACTTGACTATCATTCCCGGACTAGTTGATGTGCATGTA
CATTTATTTTTGCATGCTTATGCCGAGACGCCATGGAATGATCAAGTTACGAAAGAAAGTTTAGCGGAGCGAACC
ATTAGAGCAACAGTTCATGCACGAAGGACCCTCATGGCTGGTTTTACGACAGTAAGGGACTTGGGAACCGAGGGT
GCCCTTGACGCCGACATTAGTCTTCGCAAGTGTCTGTCTGGCCGTGAGCCAATGATATCCGGTCCGAGATACTAT
TGCGCCAATCGTGCAATTGTTACAACAGGAGCTTACGGGCCCAGGAGTTCGTTATACCCTTCAAGTCGTGGCGTG
GAGGGTGTGATGGGTGCTGAGCCAGTGGATGGGGTTGATGGTTGCATTCGGGAGGTGAGGAAGCAAGTCGGGGTG
GGAGCCGATTGGGTAAAGATCTACGCGGATTATCGTGTGCGAGCCGCAATGCAAGACGTCTCACCGTCTTTGAGT
TCGAAATCAATCCCAACATTTAACCGTCAAGAGTTAGAAGTAATGATCACGACTGCGCATGACCTTGGGGTTAAA
GTGGCAGCGCATGCCAACTCGTGGGCCGCAGTAGAAGACCTATTGGACTTAGGTGTTGACACCATCGAGCACGGC
GCCGAGATCTACAATGACCAGGATCAAAATATTAGCCTGATCAAGAAGCTTGCCGCCTCAAAGGGAAAGACAACG
TGGGTACCCACCCTAGCAGCCTACCATACATTAGGGAAATCGCGATGGGAGGCTGTCAAACAGACTTTCGTCAAG
GCCGTAATCGAAGAAGGTGTTGAAAACATAGCGTGTGGAGGGGATACGGGAGTTTTTAGTCACGGTGAGAATGCA
TTGGAATTGATCCTGATGCGACAACTTGGGGTGCCTTGGGAGAAGGTGATCTCATGGGCGACGCTTGGAGGATGG
GAATGTGTCAGAGGCTTCGAGTGGGAGGGAAGCCGGGGGCGTCAGCGAATCAGAGACCTCGAGGCGAACCCGAGA
AGGGTCTCTGACGTTGATAGAGGCATACCTTTTGGTACAATTAGGAAAGGCTGGGCCGCTGACATTGTTGGTATC
GATGGTGATTTGACAGGAAGCCCTGAAGAATTTGAGAAATCTCTCACCATGGGCGTAAAGTTGGTTATCAAAAAT
GGTAACATTGTAAAACGGGTTGGTAAATAA
Transcript >Agabi119p4|001090
ATGCCCAAAACAGAAGTTTTGGCGATCCTAGCAGGAAAACTATTTAACTCGCAGAAGCGATGTATACTGGAGGAT
CAAGTGATCATGATAGATCAAGAACTGGGCGTCATCCTTGGTGTTCTGAACCTTGGCGTTTTCAAAAGATTGCAC
GGAAAAGATGACGGTATAGACTTTATGGATCTAGGGCACTTGACTATCATTCCCGGACTAGTTGATGTGCATGTA
CATTTATTTTTGCATGCTTATGCCGAGACGCCATGGAATGATCAAGTTACGAAAGAAAGTTTAGCGGAGCGAACC
ATTAGAGCAACAGTTCATGCACGAAGGACCCTCATGGCTGGTTTTACGACAGTAAGGGACTTGGGAACCGAGGGT
GCCCTTGACGCCGACATTAGTCTTCGCAAGTGTCTGTCTGGCCGTGAGCCAATGATATCCGGTCCGAGATACTAT
TGCGCCAATCGTGCAATTGTTACAACAGGAGCTTACGGGCCCAGGAGTTCGTTATACCCTTCAAGTCGTGGCGTG
GAGGGTGTGATGGGTGCTGAGCCAGTGGATGGGGTTGATGGTTGCATTCGGGAGGTGAGGAAGCAAGTCGGGGTG
GGAGCCGATTGGGTAAAGATCTACGCGGATTATCGTGTGCGAGCCGCAATGCAAGACGTCTCACCGTCTTTGAGT
TCGAAATCAATCCCAACATTTAACCGTCAAGAGTTAGAAGTAATGATCACGACTGCGCATGACCTTGGGGTTAAA
GTGGCAGCGCATGCCAACTCGTGGGCCGCAGTAGAAGACCTATTGGACTTAGGTGTTGACACCATCGAGCACGGC
GCCGAGATCTACAATGACCAGGATCAAAATATTAGCCTGATCAAGAAGCTTGCCGCCTCAAAGGGAAAGACAACG
TGGGTACCCACCCTAGCAGCCTACCATACATTAGGGAAATCGCGATGGGAGGCTGTCAAACAGACTTTCGTCAAG
GCCGTAATCGAAGAAGGTGTTGAAAACATAGCGTGTGGAGGGGATACGGGAGTTTTTAGTCACGGTGAGAATGCA
TTGGAATTGATCCTGATGCGACAACTTGGGGTGCCTTGGGAGAAGGTGATCTCATGGGCGACGCTTGGAGGATGG
GAATGTGTCAGAGGCTTCGAGTGGGAGGGAAGCCGGGGGCGTCAGCGAATCAGAGACCTCGAGGCGAACCCGAGA
AGGGTCTCTGACGTTGATAGAGGCATACCTTTTGGTACAATTAGGAAAGGCTGGGCCGCTGACATTGTTGGTATC
GATGGTGATTTGACAGGAAGCCCTGAAGAATTTGAGAAATCTCTCACCATGGGCGTAAAGTTGGTTATCAAAAAT
GGTAACATTGTAAAACGGGTTGGTAAATAA
Gene >Agabi119p4|001090
ATGCCCAAAACAGAAGTTTTGGCGATCCTAGCAGGAAAACTATTTAACTCGCAGAAGCGATGTATACTGGAGGAT
CAAGTGATCATGATAGATCAAGAACTGGGCGTCATCCTTGGTGTTCTGAACCTTGGCGTTTTCAAAAGATTGCAC
GGAAAAGATGACGGTATAGACTTTATGGATCTAGGGCACTTGACTATCATTCCCGGACTAGTTGATGTGCATGTA
CATTGTAAGAATTCTACTAGTTCCTGGTTCAGGACGTCACATAGCATCACAACTCACCACCCCAGTATTTTTGCA
TGCTTATGCCGAGACGCCATGGAATGATCAAGTTACGAAAGAAAGTTTAGCGGAGCGAACCATTAGAGCAACAGT
TCATGCACGAAGGACCCTCATGGCTGGTTTTACGACAGTAAGGTGAGCCACTTGACACTTCCCGCCGATCGCCAG
AAGACGTGATAGGAGGTTTTGAGGGATTGTTCGGGTATAGATGATGCTGATGAGATCGTTCCACCACGTTTTACG
CTACCAGGGACTTGGGAACCGAGGGTGCCCTTGACGCCGACATTAGTCTTCGCAAGTGTCTGTCTGGCCGTGAGC
CAATGATATCCGGTCCGAGATACTATTGCGCCAATCGTGCAATTGTTACAACAGGAGCTTACGGTAAGCGCAGGC
AGAAGTTTTCGGGTTTAATCTCGGCGCCGCGTTAATTGTTACCAGGGCCCAGGAGTTCGTTATACCCTTCAAGTC
GTGGCGTGGAGGGTGTGATGGGTGCTGAGCCAGTGGATGGGGTTGATGGTTGCATTCGGGAGGTGAGGAAGCAAG
TCGGGGTGGGAGCCGATTGGGTAAAGGTGAAAATGCCCATAACTCTTTTTTTTGGAATGGGGGTTTGACCGTTGC
CATGACCTAGATCTACGCGGGTGAGGGCCATATTATTTCACCGTGTTGATAGAGCTTAACTGACTCGGATATCAG
ATTATCGTGTGCGAGCCGCAATGCAAGACGTCTCACCGTCTTTGAGTTCGAAATCAATCCCAACATTTAACCGTC
AAGAGTTAGAAGTAATGATCACGACTGCGCATGACCTTGGGGTTAAAGTGGCAGCGCATGCCAACTCGTGGGCCG
CAGTAGAAGACCTATTGGACTTAGGTGTTGACACCATCGAGCACGGCGCCGAGATCTACAATGACCAGGATCAAA
ATATTAGCCTGATCAAGAAGCTTGCCGCCTCAAAGGGAAAGACAACGTGGGTACCCACCCTAGCAGCCTACCATA
CATTAGGGAAATCGCGATGGGAGGCTGTCAAACAGACTTTCGTCAAGGCCGTAATCGAAGAAGGTGTTGAAAACA
TAGCGTGTGGAGGGGATACGGGAGTTTTTAGTCACGGTGAGAATGCATTGGAATTGATCCTGATGCGACAACTTG
GGGTGCCTTGGGAGAAGGTGATCTCATGGGCGACGCTTGGAGGATGGGAATGTGTCAGAGGCTTCGAGTGGGAGG
GAAGCCGGGGGCGTCAGCGAATCAGAGACCTCGAGGCGAACCCGAGAAGGGTCTCTGACGTTGATAGAGGCATAC
CTTTTGGTACAATTAGGAAAGGCTGGGCCGCTGACATTGTTGGTATCGATGGTGATTTGACAGGAAGCCCTGAAG
AATTTGAGAAATCTCTCACCATGGGCGTAAAGTTGGTTATCAAAAATGGTAACATTGTAAAACGGGTTGGTAAAT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail