Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|000490
Gene name
Locationscaffold_01a:114432..115142
Strand-
Gene length (bp)710
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01929 Ribosomal_L14e Ribosomal protein L14 1.7E-31 49 124
PF00467 KOW KOW motif 1.1E-05 12 42

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38754|RL14B_YEAST 60S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14B PE=1 SV=1 4 134 2.0E-36
sp|O94238|RL14_SCHPO 60S ribosomal protein L14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl14 PE=2 SV=1 6 134 4.0E-36
sp|P36105|RL14A_YEAST 60S ribosomal protein L14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14A PE=1 SV=1 4 134 1.0E-35
sp|O46160|RL14_LUMRU 60S ribosomal protein L14 OS=Lumbricus rubellus GN=RPL14 PE=3 SV=1 5 136 1.0E-31
sp|Q63507|RL14_RAT 60S ribosomal protein L14 OS=Rattus norvegicus GN=Rpl14 PE=1 SV=3 6 133 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38754|RL14B_YEAST 60S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14B PE=1 SV=1 4 134 2.0E-36
sp|O94238|RL14_SCHPO 60S ribosomal protein L14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl14 PE=2 SV=1 6 134 4.0E-36
sp|P36105|RL14A_YEAST 60S ribosomal protein L14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14A PE=1 SV=1 4 134 1.0E-35
sp|O46160|RL14_LUMRU 60S ribosomal protein L14 OS=Lumbricus rubellus GN=RPL14 PE=3 SV=1 5 136 1.0E-31
sp|Q63507|RL14_RAT 60S ribosomal protein L14 OS=Rattus norvegicus GN=Rpl14 PE=1 SV=3 6 133 1.0E-30
sp|P50914|RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 6 133 1.0E-30
sp|Q3T0U2|RL14_BOVIN 60S ribosomal protein L14 OS=Bos taurus GN=RPL14 PE=2 SV=3 6 133 3.0E-30
sp|Q9CR57|RL14_MOUSE 60S ribosomal protein L14 OS=Mus musculus GN=Rpl14 PE=1 SV=3 6 133 3.0E-30
sp|A1XQU3|RL14_PIG 60S ribosomal protein L14 OS=Sus scrofa GN=RPL14 PE=1 SV=1 6 133 3.0E-30
sp|P55841|RL14_DROME 60S ribosomal protein L14 OS=Drosophila melanogaster GN=RpL14 PE=1 SV=1 6 127 6.0E-26
sp|Q9SIM4|RL141_ARATH 60S ribosomal protein L14-1 OS=Arabidopsis thaliana GN=RPL14A PE=2 SV=1 6 133 7.0E-25
sp|Q95ZE8|RL14_DROVI 60S ribosomal protein L14 OS=Drosophila virilis GN=RpL14 PE=3 SV=1 6 127 1.0E-24
sp|Q9T043|RL142_ARATH 60S ribosomal protein L14-2 OS=Arabidopsis thaliana GN=RPL14B PE=2 SV=1 6 133 4.0E-24
sp|P55844|RL14_PEA Probable 60S ribosomal protein L14 OS=Pisum sativum PE=2 SV=1 6 133 1.0E-23
sp|Q7XYA7|RL14_GRIJA 60S ribosomal protein L14 OS=Griffithsia japonica GN=RPL14 PE=2 SV=1 5 136 5.0E-23
sp|Q24C27|RL14_TETTS 60S ribosomal protein L14 OS=Tetrahymena thermophila (strain SB210) GN=RPL14 PE=1 SV=2 6 122 4.0E-21
sp|Q54Z09|RL14_DICDI 60S ribosomal protein L14 OS=Dictyostelium discoideum GN=rpl14 PE=3 SV=1 4 133 2.0E-15
sp|Q8TX43|RL14E_METKA 50S ribosomal protein L14e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl14e PE=3 SV=1 10 88 8.0E-07
sp|P55842|RL14_TRYBB Probable 60S ribosomal protein L14 OS=Trypanosoma brucei brucei PE=1 SV=1 9 123 5.0E-06
sp|A2BME7|RL14E_HYPBU 50S ribosomal protein L14e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl14e PE=3 SV=1 10 88 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0009059 macromolecule biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0005198 structural molecule activity No
GO:1901566 organonitrogen compound biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|000490
MPESNFKRFVEVGRVVLVNDGPLAGKIAVIAEIIDHNRAIIDGPTSGIPRQAFPYKHLLLTPLKLTKLPRAAGTG
IVRKLVEQEGIVEKWDKSAWAQKRVMKEKRRSLSDFGRFKVMLAKKQRRDVVRKAVKKASA*
Coding >Agabi119p4|000490
ATGCCAGAATCAAATTTCAAGCGCTTCGTCGAGGTTGGTCGAGTTGTCCTCGTGAACGACGGTCCTCTTGCGGGA
AAAATTGCCGTCATTGCAGAGATTATCGACCACAATAGGGCAATCATCGATGGTCCTACGAGTGGTATTCCCCGC
CAAGCCTTCCCCTACAAACACCTTCTTCTCACCCCTCTCAAACTCACAAAACTTCCCCGTGCTGCAGGAACTGGA
ATTGTAAGAAAATTAGTGGAACAGGAGGGTATTGTAGAGAAGTGGGACAAGTCTGCGTGGGCGCAAAAACGGGTG
ATGAAGGAGAAGCGGAGGTCACTGAGTGACTTTGGCCGATTCAAAGTCATGCTGGCGAAGAAACAGAGACGGGAT
GTCGTCAGAAAAGCCGTCAAGAAGGCATCAGCCTAA
Transcript >Agabi119p4|000490
ATGCCAGAATCAAATTTCAAGCGCTTCGTCGAGGTTGGTCGAGTTGTCCTCGTGAACGACGGTCCTCTTGCGGGA
AAAATTGCCGTCATTGCAGAGATTATCGACCACAATAGGGCAATCATCGATGGTCCTACGAGTGGTATTCCCCGC
CAAGCCTTCCCCTACAAACACCTTCTTCTCACCCCTCTCAAACTCACAAAACTTCCCCGTGCTGCAGGAACTGGA
ATTGTAAGAAAATTAGTGGAACAGGAGGGTATTGTAGAGAAGTGGGACAAGTCTGCGTGGGCGCAAAAACGGGTG
ATGAAGGAGAAGCGGAGGTCACTGAGTGACTTTGGCCGATTCAAAGTCATGCTGGCGAAGAAACAGAGACGGGAT
GTCGTCAGAAAAGCCGTCAAGAAGGCATCAGCCTAA
Gene >Agabi119p4|000490
ATGCCAGTACGTTCGGAATTTCTGTTCAGACGGTGACTAGGTCGCATGCAGCTACGCACAGTTGGGAATTTGGGC
AAAAATCAGTTGGATGAGAGTTTGGGTCATCAGATGACGGGTTTGGCTTATCGCTGAGCTGCATGCGACCTAAAC
AATATCGGAAGGCATCTTTGAATTGACAAAGGTTTATCTTGTCTCTAGGAATCAAATTTCAAGCGCTTCGTCGAG
GTTGGTCGAGGTGTGTATAGTCAAGTCTTCGAGGCATGCCAGATTTTAGCTGACGACGCTTCGTAGTTGTCCTCG
TGAACGACGGTCCTCTTGCGGGAAAAATTGCCGTCATTGCAGAGATTATCGACCACAATAGGGTGAGTTAAATCT
ACATCATTATCGTTGGGATAGAAGTTTACATTCACTAGGCAATCATCGATGGTCCTACGAGTGGTATTCCCCGCC
AAGCCTTCCCCTACAAACACCTTCTTCTCACCCCTCTCAAACTCACAAAACTTCCCCGTGCTGCAGGAACTGGAA
TTGTAAGAAAATTAGTGGAACAGGAGGGTATTGTAGAGAAGTGGGACAAGTCTGCGTGGGCGCAAAAACGGGTGA
TGAAGGAGAAGCGGAGGTCACTGAGTGACTTTGGCCGATTCAAAGTCATGCTGGCGAAGAAACAGAGACGGGATG
TCGTCAGAAAAGCCGTCAAGAAGGCATCAGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail